Table 1

Average amino acid frequency of three immunodominant epitopes on H1N1 HA

HA epitopeAmino acid positionsAmino acid sequenceAvg frequency (%) for the following groups (samples):
ADCC++ (M1036 and M1037)ADCC+ (M1024, M1017, and M1039)ADCC (M1089)
E192–117SWSYIVETSSSDNGTCYPGDFIDYEE51.86 ± 3.1638.21 ± 0.7224.11 ± 2.55
E2124–159SVSSFERFEIFPKISSWPNHESNKGVTAACPHAGAK20.66 ± 2.2332.14 ± 2.9310.25 ± 1.19
E3470–521LKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVK15.57 ± 1.456.54 ± 1.1740.17 ± 4.09