TABLE 2.

Vaccinia virus constructs

Vaccinia virus constructbSequencea
KIRLRPGGK
RLRPGGKKK
10203040
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRE
vT135 (WT)...........K..A..............R...L.......
vT142 (K28Q)......I....K..A............Q.RM..L.......
  • a For reference, sequences are aligned to the clade B consensus sequence.

  • b NIH AIDS Research and Reference Reagent Program.