TABLE 1.

Viral evolution within the HLA-A3-restricted p17 KK9 and RK9 epitopes in subject AC-38: clonal sequencing

Days post- presen- tationClonal sequenceaClonal fre- quencyb
KIRLRPGGK
RLRPGGKKK
10203040
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRE
64.............................R..........8/17
...................W.........R..........9/17
435.............................R..........3/5
.........................I...R..........2/5
1073...........................Q.R..........6/11
...........................Q.R....I.....5/11
1213...........................Q.R..........11/14
.............G.............Q.R..........3/14
  • a For reference, sequences were aligned to the clade B consensus sequence.

  • b Clonal sequences were derived from proviral DNA.