TABLE 1.

NLSs characterized in papillomaviruses

VirusViral proteinNLS sequence(s)aReference or source
HPV5E2246RGRRYGRRPSSKSRRSQTQQRRSRSRHRSRSRSRSRSKSQTHTTWSTTRSRSTSVGKTRALTSRSRSRGRSPSTCRRGGGRSPRRRSR33335
HPV6bL25RARRRKR1171
444RKRRKR449
HPV11E2238RKRAR24279
L1481KRPAVSKPSTAPKRKRTKTKK50150
HPV16E68RPRK11This study
65KCLKFYSK72
115KQRHLDKKQR124
E7b17PETTDLYCYEQLNDSSEEEDEIDGP4115
L1510KRKATPTTSSTSTTAKRKKRK53077
HPV45L1505RRRPTIGPRKRPAASTSTASTASRPAKRVRIRSKK53950
Bovine papillomavirus type 1E184KRKVLGSSQNSSGSEASETPVKRRK10838
E2106PKRCFKKGAR11564
340KCYRFRVKKNHRHR353
  • a Bold type indicates basic residues.

  • b HPV16 E7 has no obvious NLS, and the mechanism by which wild-type E7 is targeted to the nucleus is unknown. The sequence presented here was suggested by deletion mutation analysis (15).