TABLE 5.

Conserved PyV T-antigen motifs encoded by BPCV1 early domain

VirusGenBank accession no.Sequenceb
HPDKGG box,a large T antigen
    BPCV1EU069819 34KMHPDKGGSTNAMKRLNELNQ54
    CPyVNC_007922 37MYHPDKGGDEEKMKRLNQLMD57
    FPyVNC_007923 32EFHPDKGGDPERMKELNRLMD52
    GHPyVNC_004800 34MFHPDKGGDEEKMKRLNYLME54
    BFPyVNC_004764 32KYHPDKGGDEEKMKELNTLME52
    BKVNC_001538 40EFHPDKGGDEDKMKRMNTLYK60
    JCVNC_001699 40ELHPDKGGDEDKMKRMNFLYK60
    SV40NC_001669 40EFHPDKGGDEEKMKKMNTLYK60
    SA12NC_007611 40EFHPDKGGDEDKMKRMNTLYK60
    LPyVNC_004763 40LYHPDKGGDSAKMQRLNELFQ60
    HaPVNC_001663 40QLHPDKGGNEELMQQLNTLWT60
    PyVNC_001515 40LLHPDKGGSHALMQELNSLWG60
    MptVNC_001505 40IVHPDKGGSDELSQELISLYR60
Cr2 LXCXE Rb binding area
    BPCV1EU069819 75EDLFCYESEGDDEPDTC91
    CPyVNC_007922 67ETLQCEETLYSSDEEDV83
    FPyVNC_007923 58QSLFCDETLDSDSDDGD74
    GHPyVNC_004800 63EDLFCDEELSSSEEEDV79
    BFPyVNC_004764 58EGLRADETLEDSDPEPE74
    BPyVNC_001442 58QDLHCDEELEPSDNEEE74
    BKVNC_001538 103EDLFCHEDMFASDEEAT119
    JCVNC_001699 103EDLFCHEEMFASDDENT119
    SV40NC_001669 101ENLFCSEEMPSSDDEAT117
    SA12NC_007611 103EDLFCHEDMFQSDEEGT119
    LPyVNC_004763 129DDLFCSETMSSSSDEDT145
    HaPVNC_001663 128EDLTCQEELSSSEDEFT144
    PyVNC_001515 140PDLFCYEEPLLSPNPSS156
    MptVNC_001505 101FDLFCNEAFDRSDDEQE117
Zinc finger motifs
    BPCV1EU069819 411NTIQGCKLCVKDQLLLTGLHKNHAKD--HVQHHENA444
    CPyVNC_007922 293VNPDECKDCKEDRENSSLQRLKRRRPGGHLEDHATH328
    FPyVNC_007923 275RPVEACPDCAKERETAKRQRTSHLED--HPA-HQKN307
    GHPyVNC_004800 289VPQEECADCQSQKENLCFGQLKRKWYGGHLDDHGIH324
    BFPyVNC_004764 253QPTDKCPECQKDKDTVKRKRSTHIDD--HPR-HQHN285
    BPyVNC_001442 254TAPEACKVCDNPRRLEHRRH——------HTKDHTLN281
    BKVNC_001538 299YNVEECKKCQKKDQPYHFKY——------HEK-HFAN325
    JCVNC_001699 298ENPQQCKKCEKKDQPNHFNH——------HEK-HYYN324
    SV40NC_001669 297YSFEMCLKCIKKEQPSHYKY——------HEK-HYAN323
    SA12NC_007611 298HNPEECRKCQKKEQPYHFKF——------HEK-HFAN325
    LPyVNC_004763 362VEPGKCGKCEKKQHKFHYNY——------HKA-HHAN388
    HaPVNC_001663 421QCESSCKKCAEALPRMKVHWAN——----HSQ-HLEN449
    MPyVNC_001515 443KEVPSCIKCSKEETRLQIHWKN——----HRK-HAEN471
    MptVNC_001505 314SPVPNCSKCENRMLTNHFKF——------HKE-HHEN340
  • a HPDKGG box not encoded by BPyV.

  • b Conserved motifs are in boldface.