Table 2.

Human peptide sequences

PeptideSequencea
1095         LDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
1101                   ALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
1143                   ALTTSVLKNNLCPSGSNIISNLFKEDCHQ
1144                            NLCPSGSNIISNLFKEDCHQ
1108                                  SNIISNLFKEDCHQK
1077 VVKTFHETLD
1084           CCGSSTLTA
  • a Changes between human and AGM CD81 are bolded.