Table 1.

Distribution and postendocytotic sorting of gp180 cytoplasmic domain mutants

gp180 constructaCytosolic sequencebDistributionc
Steady stateInternalized antibodies
wt..[tm]-SIKSNRHKDGFHRLRQHHDDYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKHGG
tl..[tm]-SIS/IS
stl..[tm]-SIKSNRHKDGFHRLRQHHDDYEDEIRMMSTGSKKSLLSHEFV/GV
ADA..[tm]-SIKSNRHKDGFHRLRQHHDDYEDEIRMMSTGSKKSLLSHEFQDEADAEEETLYSSKHGG/V
DDD..[tm]-SIKSNRHKDGFHRLRQHHDDYEDEIRMMSTGSKKSLLSHEFQDEDDDEEETLYSSKHGG
furint ..[tm]-SRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSALGV
furint+tm ..[tmf]-SRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSALGV
  • a wt, Myc-tagged gp180; construction of mutants stl, ADA, DDD, gp180-furint and furint+tm chimeras is described in Materials and Methods.

  • b Amino acid sequence starting at position S-1333; tm and tmf, gp180 and furin transmembrane regions, respectively; the casein kinase II recognition motifs are underlined, and point mutations introduced at the predicted phosphorylation sites are indicated in bold type.

  • c G, Golgi; S, cell surface; S/I, mostly cell surface, some intracellular; V, vesicular; V/G predominantly vesicular, some Golgi-like; G/V vice versa. For the experimental setup, see Fig. 5and Materials and Methods.