Previous Article | Next Article ![]()
Journal of Virology, July 2008, p. 7212-7222, Vol. 82, No. 14
0022-538X/08/$08.00+0 doi:10.1128/JVI.02406-07
Copyright © 2008, American Society for Microbiology. All Rights Reserved.

Department of Microbiology and Immunology, Loyola University Medical Center, Maywood, Illinois,1 Interdisciplinary Program in Immunology, Department of Microbiology, University of Iowa, Iowa City, Iowa2
Received 7 November 2007/ Accepted 25 April 2008
|
|
|---|
|
|
|---|
800 individuals. The SARS-CoV virion contains a
30-kb, plus-strand RNA genome enclosed within a pleiomorphic membrane envelope. Many of the features of this virus are known from over 25 years of research on animal coronaviruses. The 5'
2/3 of the genome encodes two very large polyproteins which are rapidly proteolyzed into components functioning in viral RNA synthesis and metabolism, while the 3'
1/3 includes several virion assembly subunits, notably the proteins spike (S), envelope (E), membrane (M), and nucleocapsid (N). Integrated both between and within these genes encoding virion proteins are eight so-called accessory genes (51). These accessory genes, originally designated numerically as open reading frames (ORFs) 3a through 9b, were identified in the original 2003 SARS-CoV isolate (strain Urbani) and are now known to be ubiquitous in SARS-CoVs obtained from infected bats, civit cats, raccoon dogs, and humans (33, 46, 64), suggesting evolutionary conservation of important viral functions. The majority of the accessory genes are expressed in SARS-CoV-infected cells (8, 10, 28, 37, 39, 48, 54, 70). Many are membrane proteins, and as antibodies have become available, several of the accessory proteins have been detected as copurifying with virions (26, 48, 50) and have been structurally resolved by X-ray crystallography (39). Although these studies have provided important information about the SARS-CoV accessory proteins, their central functions remain largely unknown. Indeed, accessory protein functions may be difficult to discern, as elimination of most of the accessory genes through reverse genetics generates recombinant SARS-CoVs with tissue culture growth properties remarkably similar to native SARS viruses (1, 16, 68). Experimental rodent models for SARS-CoV infection and disease have been recently developed (35, 45, 56, 61), and under these experimental conditions, recombinant SARS-CoVs lacking a subset of accessory genes were nearly equivalent to complete SARS-CoV in virulence and pathogenicity (2, 14, 16, 68). Thus, at present there is no satisfying explanation of the roles that these evolutionarily conserved accessory proteins play in natural animal or human SARS-CoV infections.
Accessory protein 6 has received significant scrutiny, as this protein does exhibit functions that may relate to its presumed roles in SARS-CoV infections. When expressed alone from plasmid cDNA, protein 6 ablates type I interferon signaling, indicating its potential in thwarting innate immune effectors (15, 31). Notably, several different coronavirus products may have similar immune evasion activities (31), a redundancy that presumably accounts for the inapparent in vivo consequences of ORF6 elimination from SARS coronavirus. However, when evaluated in the context of heterologous murine coronavirus infections, protein 6 has clearly recognized activities. Engineered recombinant murine coronaviruses constructed to express SARS-CoV ORF6, designated rJ.2.2.6 (recombinant JHM strain 2.2-V-1 encoding SARS p6) (41), have been compared with isogenic rJ.2.2.6-KO viruses in which ORF6 is closed via knockout (KO) of the initiation codon. Relative to rJ.2.2.6-KO, the rJ.2.2.6 viruses grow more rapidly, both in tissue culture (55) and in the murine central nervous system, and have increased in vivo lethality (40, 41). These properties of protein 6 may relate to direct effects on the coronavirus replication machinery, as protein 6 colocalizes intracytoplasmically with membrane-proximal sites of viral RNA-dependent RNA synthesis and does indeed provide for earlier viral RNA synthesis in tissue culture contexts (55).
Protein 6 is a 63-amino-acid peptide that comprises a relatively hydrophobic N-terminal portion of
40 residues and a C-terminal hydrophilic extension. The N-terminal region may function as a signal/anchor for membrane association, as protein 6 has the biochemical characteristics of an integral membrane protein (55). This membrane-associating property of the N-terminal region is presumed to operate in assisting development of viral RNA replication sites, which are well-known to reside on the interfaces between intracellular membranes and cytosol. The C-terminal region extends from membranes into cytosolic environments (40) and displays several motifs that are vital for a separate and novel activity (15). C-terminal residues of protein 6 interact with cellular importins, mediators of protein import into the nucleus (15). Accumulating protein 6 on cytoplasmic membranes titrates importins to cytoplasmic sites and thereby thwarts cellular capacity to transport cytoplasmic cargo into the nucleus. Protein 6 has been shown to impede nuclear import of proteins such as IRF3 and STAT1, key regulators of interferon gene transcription (31). While it is reasonably assumed that this activity of the protein 6 C terminus contributes to virus growth or pathogenesis by thwarting innate immune responses, there are few supporting data. In fact, alanine substitutions engineered into the C terminus did not reduce the murine neurovirulence of rJ.2.2.6 (40), leaving it unclear whether the hydrophilic cytoplasmic tail of protein 6 makes significant contributions to the growth or virulence of this related coronavirus.
These indications that unique biological activities might be separately ascribed to the N- and C-terminal regions of protein 6 led us into investigations dissecting the relative contributions of each region to recombinant JHM virus growth. In extending a recently published report (15), we found that protein 6 blocked the nuclear accumulation of proteins relying on classical nuclear import pathways, with the C terminus being vital in blocking nuclear import. More importantly, we correlated this nuclear import blockade with enhanced murine hepatitis virus (MHV) infections, giving credence to the hypothesis that this conserved, 63-amino-acid accessory protein creates superior environments for virus growth by enriching the cytosol with proteins otherwise destined to the nucleus. We found, however, that this impediment to protein import into the nucleus made only a minor contribution to virus growth, as C-terminally truncated forms of protein 6 lacking this activity still retained the majority of virus-augmenting function. These findings indicate that this small protein 6 supports murine coronavirus infections by more than one mechanism.
|
|
|---|
Plasmid constructions.
Expression plasmids encoding full-length protein 6 [pCAGGS-6 and pBMN-6 (pBMN-6-IRES-eGFP)] and C-terminal deletion mutant [pBMN-6
C (pBMN-6
C-IRES-eGFP), lacking C-terminal residues 53 to 63] were constructed using standard PCR techniques. The retroviral vector pBMN-IRES-eGFP was kindly provided by Garry P. Nolan, Stanford University, Stanford, CA (30). All clones carry a hemagglutinin (HA) tag (sequence, YPYDVPDYA) at C termini for easy detection of expressed protein by Western blot and immunofluorescence assays. Renilla luciferase reporter plasmid (pRL-TK), which contains Renilla luciferase cDNA under the herpes simplex virus thymidine kinase (TK) promoter, was purchased from Promega (Madison, WI), and firefly luciferase reporter plasmid pECMVT7Luc, containing the firefly luciferase gene under control of a bacteriophage T7 promoter, has been described previously (3).
The plasmids encoding the enhanced green fluorescent protein (EGFP) trimer with or without the nuclear localization signal (NLS) were created using methods developed by Genove et al. with some modifications (18). Briefly, an EGFP cassette was PCR amplified using forward primer 5'-ATCTCGAGTGAGCAAGGGCGAGGAGC-3' and reverse primer 5'-GAGAATTCAGCAAGGGCGAGGAGCTG-3' and ligated into pEGFP-C1 (Clontech, Inc.) to generate a construct we designate p2xEGFP. A third EGFP cassette was PCR amplified using forward primer 5'-CTGAATTCTCCGGACTTGTACAGCAGG-3' and reverse primer 5'-TTGTCGACGTCCGGACTTGTACAGCTCG-3' and cloned into p2xEGFP to yield p3xEGFP. Subsequently, oligonucleotides encoding two tandem copies of the simian virus 40 (SV40) large T antigen NLS and human heterogeneous ribonucleoprotein (hnRNPA1) nuclear localization signal (M9 NLS) were subcloned at the 3' end of the third GFP open reading frame to yield p3xEGFP-SV40 NLS and p3xEGFP-M9 NLS, respectively. The p3xEGFP-SV40 NLS encodes an
84-kDa fluorescent protein with a C-terminal-appended SV40 NLS (ELYKSGRRAQDPKKKRKVDPKKKRKV; the C-terminal GFP residues are shown in bold, linker residues are in italics, and the NLS is underlined). The p3xEGFP-M9 NLS encodes a fluorescent protein with C-terminal-appended M9 NLS (ELYKSGRRAQGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY, with C-terminal GFP residues in bold, linker residues in italics, and the NLS underlined).
Transient transfection and infection.
293T cells were grown in 10-cm2 dishes and transiently transfected with 2.0 µg pcDNA-mCEACAM1a (MHV receptor; J. Lacny and T. M. Gallagher, unpublished data) and 1 µg of p6-encoding plasmid (pCAGGS-6/pCAGGS-6-UT [untagged]/pBMN-6/pBMN-6
C) or vector control, using a calcium phosphate transfection method (47). After 24 h, transfection media were removed and cells were infected with recombinant MHV strain JHM (rJ.2.2) or rJ2.2 expressing SARS-CoV protein 6 (rJ2.2.6) at a multiplicity of infection of 0.2 PFU/cell in serum-free DMEM. After a 1-h adsorption period, the inocula were removed and infections were allowed to proceed overnight in DMEM-10% FBS.
Plaque assay and immunoblotting of virion proteins. Culture media were collected at 16 h postinfection or at other times postinfection as indicated and clarified at 2,000 x g for 20 min. In plaque assays, aliquots of clarified media were serially diluted and applied to monolayers of 17Cl-1 cells. After 1 h of adsorption, inocula were removed and cells were washed with phosphate-buffered saline (PBS) and then overlaid with DMEM containing 1% FBS and 0.5% agar (Becton Dickinson, MD). The cells were fixed at 3 days postinfection and stained with 1% crystal violet, and plaques were enumerated. For isolation and detection of virus particles, clarified medium (0.7 ml) was overlaid on 0.6-ml cushions of 20% sucrose-25 mM Na-HEPES [pH 7.4]-100 mM NaCl-0.01% bovine serum albumin. Virions were pelleted by ultracentrifugation at 200,000 x g for 30 min. Virion-containing pellets were dissolved in sodium dodecyl sulfate (SDS) solubilizer (50 mM Tris-HCl, pH 6.8, 10% glycerol, 2% SDS, 5% 2-mercaptoethanol, and 0.1% bromophenol blue), fractionated using SDS-polyacrylamide gel electrophoresis (PAGE), and immunoblotted with antibodies reacting with the HA epitope (Covance, Inc., Berkeley, CA), S proteins (monoclonal antibody [MAb] 10G; provided by Fumihiro Taguchi), M proteins (MAb J.1.3), and N proteins (MAb J.3.1; provided by John O. Fleming).
Transient transfection and luciferase assay. To evaluate the influence of protein 6 on reporter gene expression, BHK, 293T, and BSR-T7 cells were cotransfected with 1 µg of reporter plasmid (pRL-TK or pECMVT7Luc or both) and 10-fold-increasing concentrations of pCAGGS-6. The total amount of DNA was kept the same for each transfection mixture by adding empty pCAGGS-MCS vector. In 293T cells, transfections were performed with calcium phosphate transfection reagents as described elsewhere (9, 47), whereas in BHK and BSR-T7 cells, transfections were performed with Lipofectamine 2000 as recommended by the manufacturer (Invitrogen Corporation). At 24 h posttransfection (hpt), cells were rinsed twice in PBS and lysed in passive reporter lysis buffer (Promega) after resuspension at 5 x 106 cells per ml. Five-µl aliquots were assayed using luciferase assay reagent (Promega), and luminescence was recorded using a Veritas Microplate luminometer (Turner Biosystems, Sunnyvale, CA). All transfections were performed in triplicate, samples were measured in quadruplicate, and numerical uncertainties are shown by error bars.
Immunofluorescence and confocal microscopy.
To assess the nucleo-cytoplasmic distribution of NLS-containing GFP, 293T cells were grown on glass coverslips, placed into 10-cm2 dishes, and transfected with plasmids encoding reporter genes (p3xGFP-M9 NLS, p3xGFP-SV40 NLS, or p3xGFP) along with p6 expression plasmids (pCAGGS-6, pBMN-6, and pBMN-6
C) or vector control plasmids. Cells were fixed at 24 hpt in 4% paraformaldehyde for 10 min and permeabilized in digitonin buffer (300 mM sucrose, 100 mM KCl, 2.5 mM MgCl2, 1 mM EDTA, 10 mM HEPES [pH 6.9]) containing 5-µg/ml digitonin for 15 min at room temperature. The coverslips were incubated in blocking buffer (2% bovine serum albumin in PBS) for 15 min followed by an overnight incubation with primary antibody directed against HA tag at a dilution of 1:5,000. The coverslips were washed three times in ice-cold PBS at room temperature and incubated with fluorochrome-conjugated secondary antibodies (all from Molecular Probes, Inc., Eugene, OR) for 1 h at room temperature. The coverslips were washed three times in PBS and mounted with ProLong Gold antifade reagent (Invitrogen Corporation). Confocal images were captured using a Carl Zeiss model 510 laser-scanning confocal microscope. Digitized images were processed with Image J (National Institutes of Health).
siRNA transfection and MHV infections.
Predesigned small interfering RNAs (siRNAs; catalog number AM16704; siRNA ID 11218, 11125, and 145041) corresponding to exons 3 and 9 of human importin-β mRNA (accession number NM_002265), negative control siRNA (catalog number 4611), and scrambled control siRNA (GGCACAAUAUCAGCAGCGG; catalog number AM16104) were purchased from Ambion (Austin, TX). These siRNAs were transfected into 239T cells, in graded doses as indicated, along with pcDNA-mCEACAM1a, using Lipofectamine 2000 (Invitrogen). Typical experiments involved transfecting
2 x 105 293T cells with 100 nmol of siRNA and 1.5 µg of pcDNA-mCEACAM1a in 1 ml of OPTI-MEM (Life Technologies). Controls included mock transfection (transfection reagent lacking siRNA), negative control siRNA, and scrambled control siRNA. At 2 days posttransfection, cells were infected with rJ.2.2. After 16 h, supernatants were collected and infectivities were evaluated by plaque assay. Transfections were done in triplicate, and each experiment was repeated two to three times.
|
|
|---|
10-fold-more infectivity in medium from p6-expressing cells relative to vector controls (Fig. 1B). Comparative analysis of HA-tagged and untagged protein 6 revealed that the HA epitope had no influence on p6 activity (Fig. 1A and B). This augmenting effect of p6 was evident as early as 8 to 10 h postinfection (Fig. 1C and D).
![]() View larger version (57K): [in a new window] |
FIG. 1. Effects of protein 6 on MHV infections. (A) 293 cells were cotransfected with pcDNA-mCEACAM1a and pCAGGS-6, pCAGGS-6-UT (untagged), pCAGGS-3a, or empty vector. At 24 hpt, cells were infected with rJ.2.2 or a recombinant virus expressing SARS-CoV protein 6 (rJ2.2.6) at a multiplicity of infection of 0.2 PFU/cell. Supernatants were collected at 16 h postinfection (hpi) and fractionated by SDS-PAGE, and virion structural proteins (marked on left) were detected by Western blotting. Positions of molecular mass standards (in kilodaltons) are listed to the right of the gels. (B) Supernatants were titrated on monolayers of 17Cl-1 cells, and plaques were enumerated on day 3 postinfection. (C) Supernatants were collected at 12, 18, and 24 h postinfection and analyzed for secreted virus particles by Western blotting. (D) Infectivities in supernatants collected at the indicated time postinfection were enumerated by plaque assay.
|
Protein 6 reduces expression from plasmids requiring transcription in the nucleus.
Clues to the mechanism by which protein 6 increases MHV growth came from the unexpected observation that this protein suppressed the expression of cotransfecting plasmid-based genes. An example of this phenomenon is illustrated in Fig. 2A, in which 293 cells were cotransfected with plasmids encoding Renilla luciferase and p6. p6 levels correlated with significant (
5- to 10-fold) reductions in luciferase activities when samples were evaluated at 16 to 20 h posttransfection. Similar suppressive effects of p6 were recorded in sequential transfections in which 293 cells were first transfected with p6 expression vectors and then with luciferase reporter plasmids 18 h later (Fig. 2B). However, the reverse transfection order did not result in any p6-mediated effects on luciferase accumulations (Fig. 2C), suggesting that while p6 could inhibit expression from other plasmid DNA, it could not do so if the other plasmid had already become established in the cell nucleus.
![]() View larger version (23K): [in a new window] |
FIG. 2. Effects of protein 6 on reporter gene expression from cotransfected plasmids. (A) 293 cells were cotransfected with pRL-TK and with increasing amounts of pCAGGS-6. The amount of DNA for each transfection mixture was kept constant by addition of empty pCAGGS-MCS vector. Cells were lysed at 24 hpt, and Renilla luciferase luminescence was quantified. (B) 293 cells were first transfected with increasing amounts of pCAGGS-6 followed by a second transfection 18 h later to introduce pRL-TK. Luciferase luminescence was quantified at 24 hpt. (C) 293 cells were first transfected with reporter plasmid pRL-TK followed by a second transfection at 18 h with the indicated amounts of pCAGGS-6. Cells were lysed at 24 hpt, and luciferase levels were quantified.
|
Transfected plasmid DNAs are inefficiently transported from the cell cytoplasm to the nucleus (7, 57). Numerous reports have indicated that this transport can be accomplished by DNA-binding proteins that contain nuclear localization signals. These proteins attach to plasmid DNAs and escort them through nuclear pores, using the nuclear import machinery of the cell (11-13, 59, 65). To address the suggestion that protein 6 inhibits luciferase by blocking nuclear import of its plasmid DNAs, we asked whether luciferase expressed from a cytoplasmic bacteriophage T7 promoter might be immune to p6-mediated inhibition when transfected into cells containing cytoplasmic DNA-dependent T7 RNA polymerase (6, 66). To this end, BHK cells containing a cytoplasmic T7 RNA polymerase (BSR-T7) were cotransfected with vector control or p6 plasmids along with reporter plasmids encoding firefly luciferase under T7 promoter control (3). Under these conditions, p6 was indeed unable to inhibit luciferase accumulation (Fig. 3A). Parallel transfections into parental BHK cells lacking T7 RNA polymerase only generated a background luciferase activity. These data, normalized to cotransfecting nuclear-based Renilla luciferase expression, clearly revealed that the nuclear Renilla but not cytoplasmic firefly luciferase accumulation was inhibited in BSR-T7 cells by protein 6 (Fig. 3B). Together these data suggest that the inhibitory effect of protein 6 is at the level of plasmid DNA transport from the cytoplasm to the nucleus.
![]() View larger version (13K): [in a new window] |
FIG. 3. Luciferase expression from nuclear and cytoplasmic promoters in protein 6-expressing cells. (A) BHK and BSR-T7 cells were cotransfected with pECMVT7Luc and pCAGGS-6 or empty vector. Cells were lysed at 24 hpt, and luciferase activities were quantified. The data represent means ± standard deviations of a representative experiment done in triplicate. (B) BSR-T7 cells were cotransfected with reporter plasmids (pRL-TK and pECMVT7Luc) and pCAGGS-6 or empty vector. At 24 hpt, cells were lysed and Renilla or firefly luciferase activities were determined. Data are presented as percent changes in luciferase activities in protein 6-expressing cells relative to empty vector-transfected cells.
|
60 kDa (19, 20). Therefore, we constructed reporter plasmids encoding three tandem copies of green fluorescent protein, with or without C-terminal-appended nuclear localization signals (SV40 NLS and M9 NLS) (27). These constructs, designated 3xGFP, 3xGFP-SV40 NLS, and 3xGFP-M9 NLS, respectively, were proteins of 84 to 90 kDa and therefore exceeded the size limit for passive diffusion into the nucleus (4). 293 cells were cotransfected with these reporter plasmids, along with vector control or p6-expressing plasmids, and then monitored 1 day later by fluorescent microscopy. As expected, the 3xGFP protein was restricted to the cytoplasm, with p6 having the expected suppressive effect on its abundance but no effect at all on its cytoplasmic distribution (Fig. 4A). In striking contrast, the 3xGFP-SV40 NLS efficiently accumulated in the nuclei of vector control-transfected cells, with p6 exerting a pronounced blockade of this nuclear accumulation (Fig. 4A). Indeed, the distribution of 3xGFP-SV40 NLS in p6-expressing cells was essentially identical to that of 3xGFP lacking an NLS, suggesting that p6 interfered with the nuclear import of classical NLS-bearing proteins. Quantitative data revealed that relative to vector-transfected cells, p6 effectively blocked the nuclear accumulation of 3xGFP-NLS in more than 85% of the cells (Fig. 4B). Notably, this p6-mediated inhibition of 3xGFP-SV40 NLS was transient. At 2 days posttransfection, significant proportions of the 3xGFP-SV40 NLS accumulated in the nuclei of p6-expressing cells (data not shown), suggesting that p6 operated to delay but not entirely eradicate the import of NLS-bearing proteins. We also found that nucleo-cytoplasmic distribution of 3xGFP-M9 NLS was not affected by p6, with clear evidence of nuclear accumulation in the presence and absence of p6 (Fig. 4A). Thus, we conclude that p6 interfered with a subset of the known nuclear import pathways (42, 63), leaving the transportin-dependent nuclear import pathway intact and perhaps also leaving slower alternate routes available for 3xGFP-SV40 NLS cargo to enter into nuclei. These observations are consistent with the absence of overt toxicity in cells accumulating protein 6.
![]() View larger version (36K): [in a new window] |
FIG. 4. Nucleo-cytoplasmic distribution of GFP-NLS in protein 6-expressing cells. (A) 293 cells were cotransfected with the indicated reporter plasmids and pCAGGS-6 or empty vector. Cells were fixed at 24 hpt and probed with monoclonal antibody directed against HA tag. The protein 6 expression and nucleo-cytoplasmic distribution of GFP were visualized using laser-scanning confocal microscopy, and representative images are shown. (B) The percentages of cells with nuclear and cytoplasmic GFP were calculated by counting 10 random fields from each transfection. Cells with distinct cytoplasmic fluorescence to uniform nuclear-cytoplasmic fluorescence were scored as cytoplasmic fluorescence, and cells with distinct nuclear staining were scored as nuclear fluorescence. Data represent means ± standard deviations of 10 field counts. Cells with p6 had lower GFP intensities, thus longer exposure times were employed to match the signal intensities relative to vector control transfectants.
|
A series of protein 6 truncation mutants, generated by standard methods as described in Materials and Methods, were evaluated for their capacity to augment MHV infections and to prevent nuclear entry of 3xGFP-SV40 NLS. The most instructive p6 mutant was a C-terminal-truncated form lacking 11 amino acids, designated p6
C. In the MHV infection assays, we found that this mutant retained
80% of the complete p6 capacity to augment output of infectivity and virion particles, as measured by plaque assay and immunoblot analysis of secreted virion proteins (Fig. 5). In the transfected cells, the accumulations and subcellular localizations of these mutants were indistinguishable from the complete 6 proteins (Fig. 5 and data not shown), indicating that the incomplete augmenting activities of this mutant could not be explained by reduced abundance or position within the cells.
![]() View larger version (51K): [in a new window] |
FIG. 5. Effect of the C-terminal deletion of p6 on MHV infections. 293 cells were transfected with pcDNA-mCEACAM1a and plasmid encoding full-length (pBMN-6) or mutant (pBMN-6 C) protein 6 or empty vector. Cells were infected at 24 hpt with MHV-rJ2.2 at 0.2 PFU/cell. At 16 h postinfection, media were collected and analyzed for infectivity by plaque assay and for virion particle content by immunoblotting. The intracellular protein 6 accumulations were determined by immunoblotting (lower panel).
|
20 to 30%) of protein 6-mediated MHV-augmenting activity is related to its ability to prevent NLS-containing proteins from entering the nucleus. The remaining portion (
70 to 80%) of the augmenting activity presumably operates by a distinct mechanism.
![]() View larger version (43K): [in a new window] |
FIG. 6. Effects of the C-terminal deletion on nuclear import of 3xGFP-SV40 NLS. 293 cells were cotransfected with p3xGFP-SV40 NLS and plasmid encoding full-length (pBMN-6) or mutant (pBMN-6 C) protein 6. At 24 hpt, cells were fixed and probed with monoclonal antibody specific to HA tag. Images were acquired using laser-scanning confocal microscopy, and representative micrographs are shown.
|
Three importin-β-specific and two different negative control siRNAs were evaluated in our experiments. Relative to the control siRNAs, 100 nM importin-β siRNAs 1, 2, and 3 reduced importin-β steady-state levels by 30 to 50% at 2 days posttransfection (Fig. 7A). These reductions did not have untoward toxic effects, as siRNA- and mock-treated cells were indistinguishable in integrity, adherence, and growth rate for up to 72 h posttransfection. Notably, these levels of importin-β reduction caused only a partial interference with the nuclear import of 3xGFP-SV40 NLS (data not shown), less stringently than that generated by protein 6. A combination of siRNAs 2 and 3, which target importin-β exons 3 and 9, was increasingly effective at preventing the nuclear localization of 3xGFP reporter protein (Fig. 7B).
![]() View larger version (55K): [in a new window] |
FIG. 7. Effects of importin-β down-regulation on MHV infections. (A) 293 cells were transiently transfected with siRNAs (100 nmol each) targeting exons 3 and 9 of importin-β mRNA or scrambled control siRNA. At 48 hpt, cells were lysed in 0.5% NP-40 and fractionated by SDS-PAGE followed by immunoblotting with anti-importin-β and anti-β-actin antibodies. (B) 293 cells were transiently transfected with red fluorescent protein (RFP) as a transfection control and the indicated amounts of importin-β siRNAs (siRNA 2 and 3) followed by a second transfection with p3xGFP-SV40 NLS at 48 h. After 24 h cells were fixed and nucleo-cytoplasmic distributions of 3xGFP-NLS were determined by laser-scanning confocal microscopy. Intracellular levels of importin-β and the housekeeping gene β-actin in siRNA (siRNA 2 and 3)-treated cells were determined by immunoblotting (lower panel). (C) 293 cells were transfected with pcDNA-mCEACAM1a and increasing doses of importin-β or scrambled control siRNA. At 2 day posttransfection, cells were infected with rJ.2.2 at 0.2 PFU/cell. Culture media were collected at 16 to 18 h postinfection, and secreted infectivities were determined by plaque assay. Importin-β levels (lower panel) were determined by immunoblotting.
|
|
|
|---|
We reasonably hypothesized that the hydrophobic, membrane-intercalating N-terminal
50 residues of protein 6 might be involved in the interactions with viral RNA synthetic machinery, as cytoplasmic membranes are the sites for replication of this plus-strand RNA virus (21, 52). The charge-rich C-terminal
15 residues of protein 6 have been clearly implicated in preventing STAT1 from entering nuclei (15), and in doing so potentially thwarting innate antiviral responses. With this knowledge, we considered whether protein 6 forms lacking their C termini might operate to accelerate rJHM infections. Thus, we constructed mutant ORF6 cDNAs and expressed them to accumulate the various truncated proteins and then infected with rJ.2.2 to determine whether cells might be primed for more rapid and efficient MHV infection. These straightforward experiments revealed convincing evidence that the complete p6 proteins could prime cells for early replication and subsequent rapid infectious progeny output (Fig. 1). In these experiments we found only modest roles for the protein 6 C termini (Fig. 5). Clearly, the primary effects of protein 6 in these experimental contexts were provided by the N-terminal hydrophobic portion (Fig. 5).
Previously, we analyzed protein 6 function in cells infected with rJ2.2.6 and reported that the C-terminal part was not required for enhancement of MHV replication in cell cultures or in mice (40). However, in the present study, using transfected cDNA, we showed that deletion of the 11 amino acids at the C terminus partially (
20%) diminished protein 6's enhancing ability. There are several differences when protein 6 is expressed in trans compared to expression by a recombinant virus. Most importantly, protein 6 is expressed prior to MHV infection and at higher levels when expressed in trans, compared to expression in the context of recombinant virus. Thus, the role of inhibition of nuclear import may be most important in enhancing rJ2.2.6 replication at later times postinfection, when the protein is expressed at higher levels; this effect is more obvious in transfected cells when the protein is present at high levels throughout the infection. Consistent with this lack of requirement for the C-terminal part of p6 when analyzed in the context of recombinant virus, STAT1 translocation into the nucleus was only inhibited at very late times postinfection and only after syncytia had formed (H. Zhou and S. Perlman, unpublished observations).
The central activity of the protein 6 C terminus that we could identify was an effect on the cell and was largely independent of effects on the virus. In studies performed independently and concomitantly with those of Frieman et al. (15), we found that protein 6 interfered with classical NLS-containing protein import into the nucleus. Here we used proteins that could indicate the integrity of the nuclear import machinery, tandemly repeated GFPs connected to two different NLS motifs. These proteins exceeded the size limits for passive entrance into the nucleus. We found that our 3xGFP-SV40 NLS was strikingly excluded from the nucleus by overexpressed complete protein 6, but not at all by protein 6 forms lacking their C-terminal 11 amino acids (Fig. 6). Thus, it is clear that our experiments and results only modestly support the hypothesis that protein 6 supports coronavirus infection by preventing antiviral factors from accessing the nucleus and activating host antiviral gene expression. Instead, the alternative view is of protein 6 directly interacting with other viral factors, most likely RNA replicative components (55). These sorts of findings may arise because the mouse hepatitis virus we are using to evaluate the functions of SARS-CoV protein 6 encodes its own endogenous antiviral effectors. All coronaviruses encode nonstructural protein1 (nsp1) and N, which for the MHVs have recently been identified as type 1 interferon antagonists (67, 73). An additional interferon-antagonizing activity in the C terminus of SARS-CoV protein 6 might be inapparent in the context of these nsp1 and N proteins, resulting in a separate activity for protein 6 that is independent of the interferon response as the primary observed "phenotype."
Even though the C terminus of SARS-CoV protein 6 had minimal MHV-enhancing activity, we were intrigued by its capacity to restrict admission of proteins and even plasmid DNAs (Fig. 2) into the nucleus. The cargo proteins evaluated thus far, IRF3 (32), STAT1 (49), and 3xGFP-SV40 NLS (this report), each uses the so-called "classical" nuclear import pathway. These proteins depend on importin-β and associated adaptor proteins for transport through nuclear pores and are set apart from M9 NLS-containing proteins, such as hnRNPA1 and Nup153 proteins, which use nonclassical nuclear import pathways (36, 38). Using two distinct NLS forms on our 3xGFP reporter, we found that protein 6 deterred SV40-NLS containing GFP, but not M9-NLS containing GFP, from nuclei (Fig. 4A). This demonstrates that protein 6 selectively restricts protein cargo from the nucleus, only limiting the more commonly transported proteins relying on the classical nuclear import pathway. These findings bring new appreciation for this viral protein, which may have evolved to selectively restrain those proteins conferring antiviral responses while allowing free flow of host proteins that are vital for host cell and virus growth. Notably, we have observed little cytopathology associated with abundant protein 6 expression over a 3-day period (data not shown).
Another interesting question regarding the C-terminal portion of protein 6 is whether its capacity to sequester importins (and thus block host protein cargo from entering nuclei) is truly the operating mechanism by which it modestly improves MHV growth in the 293 cells. This question was indirectly addressed by reducing importin-β activities by methods independent of protein 6 and then determining the influence, if any, on MHV growth. Therefore, in the transfections that preceded MHV infection, we replaced protein 6 with siRNAs specific for importin-β mRNAs. Our results indicated that single siRNA treatments were not sufficient, but combinations of two different siRNAs did significantly reduce the nuclear accumulation of 3xGFP-SV40 NLS (Fig. 7B). These findings could be attributed to importin-β levels, as immunoblot assays did reveal reductions of this crucial protein carrier (Fig. 7A). Here it is worth noting that the modestly reduced importin-β levels in the cultures may not accurately reflect the levels in the
50% of siRNA-lipofected cells; this is an important consideration because the MHV infections were targeted specifically to siRNA-positive cells via cotransfection of siRNAs with plasmids encoding the MHV receptor. In parallel experiments, cells cotransfected with MHV receptor plasmids and siRNAs did clearly enhance the production of infectious MHVs, to levels about 5-fold (ranges from 4- to 10-fold) above those generated by control siRNAs (Fig. 7C). Thus, we can suggest that a blockade of classical NLS-containing proteins from nuclear entry, either by the complete protein 6 or by siRNAs, can prime 293 cells for improved MHV production. These findings that siRNAs can functionally replace the C-terminal residues of protein 6 argue for a bifunctional accelerator of MHV growth, with the N-terminal residues making major contributions and the C-terminal residues contributing independently once the levels of protein 6 are sufficiently high to achieve titration of nuclear import factors.
Our data argue that inactivating the classical nuclear import pathway can modestly improve MHV replication. Nuclear transport machinery controls the bidirectional transport of many biologically important molecules, and these pathways must be maintained for host cells to mount effective antiviral responses. Disruption of the nuclear transport machinery is part of viral cytopathogenic effects and constitutes mechanisms by which viruses may circumvent host antiviral responses (23, 43, 44, 62). In these cases, depleting nuclei of essential gene expression factors hinders antiviral responses. At the same time, host cells impaired in generalized nuclear import pathways will develop cytosol enriched with certain proteins that may benefit infection by cytoplasmically replicating plus-strand RNA viruses. It is not yet clear whether the advantages to MHV growth derive from restricted transport of antiviral factors into host cell nuclei and/or from cytosolic enrichment of proviral proteins that normally transit into nuclei. However, the relatively profound in vitro resistances that most MHVs exhibit toward immediate-early interferons (60, 67, 72, 73) suggests that the SARS-CoV protein 6 enhances MHV infections in ways distinct from a (redundant) antagonism of interferon signaling. We are interested in determining whether the distribution of proteins in cell nuclei and cytosol might be globally altered by protein 6 in ways that create superior environments for the replication of coronaviruses.
This work was supported in part by a grant from the NIH (PO1 A1060699).
Published ahead of print on 30 April 2008. ![]()
|
|
|---|
1 and blocks STAT1 nuclear accumulation. J. Virol. 80:5156-5167.This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»