Previous Article | Next Article ![]()
Journal of Virology, January 2005, p. 1125-1132, Vol. 79, No. 2
0022-538X/05/$08.00+0 doi:10.1128/JVI.79.2.1125-1132.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
Sandra L. Quackenbush,2
Rufina N. Casey,1
Joel Rovnak,2
George H. Balazs,3
Thierry M. Work,4
James W. Casey,1* and
Claudia A. Sutton1
Cornell University Department of Microbiology and Immunology, Ithaca, New York,1 Colorado State University Department of Microbiology, Immunology, and Pathology, Fort Collins, Colorado,2 National Marine Fisheries Service, Pacific Islands Fisheries Science Center, Honolulu Laboratory,3 United States Geological Survey, National Wildlife Health Center Honolulu Field Station, Honolulu, Hawaii4
Received 30 June 2004/ Accepted 30 August 2004
|
|
|---|
|
|
|---|
Marine turtle fibropapillomatosis is associated with a herpesvirus infection (17, 21, 30, 31). Herpesvirus polymerase sequences have been detected by PCR in DNA from every tested fibropapilloma and fibroma reported to date (17, 21, 30, 31). In 79% of fibropapillomas and fibromas examined by real-time quantitative PCR, viral sequences were present at levels exceeding 104 copies per 100 ng of total tumor DNA, i.e., an average of one virus copy per tumor cell (31). The magnitudes of these loads indicate that viral gene products could be present in sufficient quantities to serve as driving forces for tumor development and/or maintenance. Viral polymerase gene expression has not been detected in fibropapillomas or fibromas, suggesting that infection is predominantly latent in tumors, comparable to human herpesvirus 8 in Kaposi's sarcoma lesions or gallid herpesvirus 2 in the tumors associated with Marek's disease of chickens (10, 32, 33, 36). This putative disease agent has been called the green turtle herpesvirus or the FPTHV. Because FPTHV provides a new model system with which to examine the emergence of a virus and virus-related oncogenesis, we have begun to sequence its genome as a basis for further study.
The apparent increase in prevalence of FP since the first reports in Florida (22, 34), combined with ongoing reports of outbreaks in new geographic areas, has raised speculation that FP emergence reflects a recent introduction of FPTHV into marine turtle populations. An alternative hypothesis is that FPTHV was already established in marine turtles when FP arose as the result of an interaction between the virus and additional environmental cofactors. The latter hypothesis is consistent with published observations that the disease is more prevalent in habitats that are proximal to agricultural and urban development (2, 12, 19). Turtle populations occupying more-pristine waters adjacent to the FP-enzootic areas listed above remain free of FP (2, 12, 19). The first objective of this study was to sequence a sufficiently large block of the FPTHV genome to compare FPTHV to the fully sequenced herpesviruses. The second was to align FPTHV sequences from various geographic locations and host turtle species. Convincing phylogenetic data have resulted from similar analyses of genetic diversity among geographic variants of human herpesvirus 8 (40, 41).
|
|
|---|
library was performed as described in reference 18, from the eye tumor of an immature female green turtle collected at Maui, Hawaii. Genomic DNA was prepared and partially digested with MboI and size selected on a 5 to 20% potassium acetate gradient; fragments of 15 to 20 kb were cloned and packaged using the lambda DASH II/BamHI vector kit (Stratagene, La Jolla, Calif.) and Gigapak II XL packaging extract according to the manufacturer's instructions. Clones (106) were screened with a 32P-labeled FPTHV pol sequence (pHaGTHV) (30).
Cloning and sequencing. (i) Lambda library.
The fragments from eight positive
clones were subcloned into the pCR-XL-TOPO vector (Invitrogen Corporation, Carlsbad, Calif.). Subclones were sequenced with an ABI 373A automated sequencer (Applied Biosystems, Inc., Foster City, Calif.) at the Biotechnology Resource Center at Cornell University. The SeqMan program from the Lasergene software package (DNASTAR, Inc., Madison Wis.) was utilized to assemble the sequence data into a contig of 23,055 bp.
(ii) Geographic and species comparisons. Nine FPTHV subclones, corresponding to six overlapping amplicons from the glycoprotein B (gB) open reading frame, one amplicon from the DNA polymerase (pol) open reading frame, and two overlapping amplicons from the UL34 region, were PCR cloned from each of nine geographically diverse FP samples. The gB and UL34 primers utilized are listed in Table 1; the pol primers (GTHV2 and GTHV3) were published previously (30). Amplification from pol utilized the original reaction conditions (30). Amplification with all the gB primer sets and also UL34 set A was performed in a 100-µl volume containing 1 µg of target DNA, 20 mM Tris-HCl (pH 8.3), 2 mM MgCl2, 50 mM KCl, 2.5% dimethyl sulfoxide, 200 µM (each) deoxynucleoside triphosphates, 10 pmol (each) of primer, and 2.5 U of Taq DNA polymerase (Invitrogen). The mixture was incubated 5 min at 94°C and then subjected to 35 cycles of 94°C for 30 s, 57°C for 20 s, and 72°C for 20 s, followed by a hold of 5 min at 72°C. Amplification with the UL34 primer set B used the same reaction mixture; thermal cycling began with a 5-min incubation at 94°C, followed by 40 cycles of 94°C for 30 s and 72°C for 30 s, and then a hold of 10 min at 72°C. Cloning, sequencing, and contig assembly were carried out as described above.
|
View this table: [in a new window] |
TABLE 1. Primers used for amplification of compared FPTHV gB and UL34 sequences
|
Sequence alignments and phylogeny. Alignments of the nine FPTHV nucleotide sequence blocks were constructed by using a ClustalW alignment by the Lasergene software package (DNASTAR, Inc.). A phylogenetic tree was constructed with the NEIGHBOR algorithm of the Phylogeny Inference Package (PHYLIP) (http://evolution.genetics.washington.edu/phylip.html). Alignment of the amino-terminal domains of the UL26-homologous open reading frames of FPTHV and other herpesviruses utilized the Jotun Hein algorithm of the MegAlign program from the Lasergene software package.
Additional sequences used for geographic and host comparisons of the pol gene are Australian Green pol (AF299108), Australian Loggerhead pol (AF299107), Barbados Green pol (AF299110), Costa Rica Olive Ridley pol (AF049904), Florida Green pol (AF035004), and Hawaii Green 2 pol (AF035003 bases 15840 to 16322) (30).
The lung-eye-trachea disease virus (LETV) sequences used for comparisons below are UL26/UL26.5 (AY124578), UL27 (AY124557), and a partial sequence of UL30 (pol) (AAM95779 (5).
Additional herpesvirus sequences used in alignments below are the genome sequences of human herpesviruses 1 (NC001806), 3 (NC001348), 4 (NC001345), and 5 (NC001347), gallid herpesvirus 2 (NC002229), and equine herpesvirus 1 (NC001491) and partial sequences from gallid herpesvirus 1 (AB024414).
Nucleotide sequence accession numbers. The new sequences derived here have been submitted to GenBank. Accession numbers are as follows (in parentheses): UL23-UL26 contig (AF035003), Australian Green UL27 (AY390402), Australian Loggerhead UL27 (AY390403), Barbados Green UL27 (AY390404), Costa Rica Olive Ridley UL27 (AY390405), Florida Green UL27 (AY390406), Hawaii Green 1 UL27 (AY390407), Hawaii Green 2 UL27 (AY390408), Puerto Rico Green UL27 (AY390409), San Diego Green UL27 (AY390410), Hawaii Green 1 pol (AY390420), Puerto Rico Green pol (AY390421), San Diego Green pol (AY390422), Australian Green UL34 (AY390411), Australian Loggerhead UL34 (AY390412), Barbados Green UL34 (AY390413), Costa Rica Olive Ridley UL34 (AY390414), Florida Green UL34 (AY390415), Hawaii Green 1 UL34 (AY390416), Hawaii Green 2 UL34 (AY390417), Puerto Rico Green UL34 (AY390418), and San Diego Green UL34 (AY390419).
|
|
|---|
![]() View larger version (15K): [in a new window] |
FIG. 1. Lengths, positions, orientations, and homologies of open reading frames in the FPTHV contig (GenBank accession number AF035003).
|
|
View this table: [in a new window] |
TABLE 2. Homology of FPTHV open reading frames to those of other alphaherpesviruses
|
The UL26 gene of LETV, another disease-associated herpesvirus of green marine turtles (5), shows greater homology to FPTHV UL26 than the model viruses in Table 2. The primary sequence of LETV UL26 is 33% identical and 48% similar to FPTHV UL26, and the alignment between the two extends into the UL26.5 area of the ORFs. LETV also bears the highly conserved histidine residues discussed above (see Table S2 in the supplemental material).
UL26.5. The open reading frame at 4125 to 5006 is homologous by position (overlapping the 5' end of UL26) to the virion scaffolding protein genes of alphaherpesviruses. The sequence of these genes is not conserved across the alphaherpesvirus genera, so no significant similarities to the model alphaherpesviruses were detected (Table 2). The predicted amino acid sequence of this ORF, however, is 26% identical to the UL26.5 homolog of LETV (5) (Table 2).
UL29. The predicted amino acid sequence of the ORF at 13735 to 10877 bears herpesvirus single-stranded DNA binding protein homology, with 29 to 34% identity and 46 to 51% similarity to the model alphaherpesviruses (Table 2). This homology includes a putative conserved zinc finger motif at predicted positions 491 to 502 (CDLCDVETRHVC; Zn finger consensus sequence is C- X2-5-C-X2-15-C/H-X2-4-C/H, where bold indicates conserved residues) (11), followed by a putative conserved DNA binding domain (R795AEKVMQLQPILNGPHGYLLKRFHERLFPTN KAISAMAFWNRAQNNK; the UL29 DNA binding consensus motif is K/R-X2-3-K/R-X9-10-F-X4-F-X1-3-K/R-X10-12-W-X6-R (16). The UL29 nucleotide sequence reported here is >99% identical to a FPTHV UL29 sequence in GenBank (27).
UL30. The previously published 482-bp FPTHV pol sequence (30) is a portion of this ORF, 13,896 to 17,171. This ORF is the most homologous to those of the comparison viruses, bearing 42 to 45% identity and 58 to 60% similarity in predicted primary sequence (Table 2). The predicted amino acid sequence of FPTHV UL30 contains homologs to all of the nine domains highly conserved among herpesvirus pol genes (Fig. 2) (35). Of the 130 amino acid residues conserved among equine herpesvirus 1, VZV, HSV-1, gallid herpesvirus 2 (Marek's disease virus [MDV]), human herpesvirus 4 (Epstein-Barr virus), and CMV at these loci, FPTHV shares 123 (95%). Of the seven substitutions, four conserve the charge and approximate size of the consensus residue (98% identical or similar). Of an additional 83 residues shared by just the four alphaherpesviruses listed above, FPTHV shares 55 (66%); of the 28 substitutions, 22 are by similar residues (93% identical or similar). The pol nucleotide sequence reported here is 98% identical to an FPTHV pol sequence in GenBank (39); discrepancies between the two are concentrated at the 5' end of the ORF, after the sequence encoding the ninth conserved polymerase domain.
![]() View larger version (23K): [in a new window] |
FIG. 2. Predicated amino acid sequences of FPTHV UL30 in domains highly conserved among herpesvirus DNA polymerase catalytic subunits (35). Underline, amino acid positions conserved among equine herpesvirus 1, VZV, HSV-1, and Marek's disease virus of chickens. Bold, amino acid positions conserved among the four alphaherpesviruses listed above and also Epstein-Barr virus and CMV. When the sequence of FPTHV differs from either consensus, the consensus residue is provided below. The location of each domain in the 1,091-amino-acid predicted primary sequence of FPTHV pol is to the right.
|
UL34. The open reading frame at 20153 to 20947 has 23 to 25% identity and 40 to 43% similarity to the UL34 (membrane-associated phosphoprotein) genes of MDV, VZV, and HSV-1 in the central 150 residues of its predicted translation (Table 2). This conserved central region includes a motif of unknown function, L148XFRF, which is highly conserved among alphaherpesviruses (13). Interestingly, the C-terminal 100-residue region of FPTHV UL34 does not align with the C termini of any of the model viruses; however, in accordance with the hypothesized role of this domain in membrane anchoring, it is significantly (36%) hydrophobic, like the corresponding portions of HSV-1 (43%), VZV (38%), MDV (36%), and infectious laryngotracheitis-like viruses (ILTV) (38%). The N-terminal region of the FPTHV UL34 ORF does not align with those of MDV or VZV, and the ILTV UL34 gene bears no significant similarity to the FPTHV homolog. It was because of this apparent variability in UL34 sequences that the UL34-UL35 region was chosen for the FPTHV sequence diversity analysis described below.
Comparisons to Alphaherpesvirinae genera. The predicted primary amino acid sequences of the 13 complete FPTHV ORFs above were compared to those of 4 other alphaherpesviruses (Table 2). Each of these four comparison viruses is a founding member of one of the currently established genera (reviewed in reference 33): simplexviruses (HSV-1), varicelloviruses (VZV), Marek's disease-like viruses (MDV), and infectious laryngotracheitis-like viruses (ILTV) (infects chickens, pheasants, and peafowl). These comparisons discouraged assignment of FPTHV to any of these genera; the ORFs of FPTHV had similarly low homology to ORFs of all of the model viruses. (For comparison, within the Simplexvirus genus, cercopithecine herpesvirus 1 is 51.8 to 84.0% identical to HSV-1 and 47.3 to 84.8% identical to HSV-2 in the predicted amino acid sequences of its UL23-UL36 ORFs [28].) However, there is a partially characterized herpesvirus that appears from available sequence data to be more homologous to FPTHV than any of these four: the LETV, which also infects green marine turtles (C. mydas). The UL27-homologous ORF of LETV is 40% identical to that of FPTHV (compared to the 31% identity between FPTHV and ILTV at this locus), and at the time of publication the UL26.5-homologous ORF of LETV was the only sequence in GenBank with significant similarity (26% identical) to the putative FPTHV UL26.5 discussed above. In addition, the published partial sequence of LETV UL30 (5) is 57% identical to FPTHV UL30 amino acid positions 751 to 809. This level of homology is also greater than those found for any of the four model alphaherpesviruses. The limited sequence data available thus suggest that FPTHV and LETV will eventually be grouped together in a new alphaherpesvirus genus.
Comparisons among FPTHV sequences from diverse marine turtles. Portions of the FPTHV open reading frames homologous to UL27, UL30, and UL34, encompassing a total of 3,748 bp, were cloned and sequenced from fibropapillomas of nine geographically and genetically diverse FP-affected marine turtles. Greater than 96% nucleotide sequence conservation was found among the viruses infecting these animals (C. mydas from Hawaii, Florida, Australia, Puerto Rico, Barbados, and California, C. caretta from Australia, and L. olivacea from Pacific Costa Rica). However, there were sequence variations that correlated with geographic location. Figure 3 provides a summary of the nucleotide substitutions and deletions in the nine isolates analyzed. A phylogenetic tree based on the sum of the three sequences from each virus sample is shown in Fig. 4.
![]() View larger version (36K): [in a new window] |
FIG. 3. Positions and identities of nucleotide substitutions among the FPTHV geographic variants. Substitutions that alter the identity of the encoded amino acid are underlined. Source species and geographic abbreviations: green, C. mydas; loggerhead, C. caretta; Olive Ridley, L. olivacea; Aust., Australia; HI-1, Hawaii, turtle one of two; HI-2, Hawaii, turtle two of two (same source as contig); CR, Costa Rica; SD, San Diego; Barb, Barbados; FL, Florida; PR, Puerto Rico.
|
![]() View larger version (16K): [in a new window] |
FIG. 4. Phlyogenetic tree of FPTHV geographic and host species variants generated for the total compared sequence block by NEIGHBOR (PHYLIP). Bootstrap values for each node are provided. Compared regions correspond to FPTHV contig (AF035003) positions 5186 to 7667, 15840 to 16242, and 20072 to 20932 (3.7-kB total). Species abbreviations: G, green; OR, olive ridley; log, loggerhead.
|
|
|
|---|
FPTHV sequence variation. Among human herpesviruses, distinct genetic variants have been found to partition in geographically defined populations (8, 9, 25, 26, 29). This herpesvirus phylogeography is most extensively characterized in human herpesvirus 8 (HHV-8) (the Kaposi's sarcoma-associated herpesvirus), for which four geographic clades have been identified (40, 41). Based on these findings and early observations that FPTHV polymerase variants were found in different geographic regions (30, 31), we carried out a genetic analysis to determine whether there are variants of FPTHV corresponding to the host species or geographic location. For phylogenetic inference among FPTHVs, the UL27, UL30, and UL34 loci were selected as potentially variable (based on comparisons to other alphaherpesviruses [Table 2]). The inclusion of portions of three different ORFs was also intended to control for variation in the rates of evolution of individual genes, a phenomenon observed in other alphaherpesviruses (24).
FPTHV variants: by host geography, not species. Four FPTHV variant groups were revealed by this analysis: the Florida and Barbados sequences form an Atlantic Ocean group, the Hawaii sequences form a mid-Pacific group, the Australia sequences form a west Pacific group, and the Costa Rica and California sequences form an east Pacific group (Fig. 4). Figure 3 provides a summary of the substitutions and deletions that differentiate the clades.
The identities of the four geographic clades revealed here are fairly clear-cut. The Atlantic group displays a 0.98% divergence from the west Pacific and mid-Pacific groups. The west Pacific and mid-Pacific FPTHVs are quite similar in sequence (0.42% total divergence), but the mid-Pacific group sequences are distinguished by a 6-bp in-frame deletion at positions 1164 to 1169 in the glycoprotein B sequence (Fig. 3). The Atlantic, west Pacific, and mid-Pacific groups collectively differ extensively from the east Pacific group, ranging from 2.8 to 3.1% nucleotide substitutions. The east Pacific group had the highest internal nucleotide variability of the four; the east Pacific group may separate into multiple groups when a more comprehensive analysis includes additional sequences from FP cases in Pacific Mexico and Baja, Calif. The Puerto Rico variant did not cluster with any of the geographic groups defined here; it could belong to a separate Caribbean group. Extending this analysis to include a larger sampling size and more variable genome regions may clarify the relationship of this variant to the others.
This portion of our study succeeded in paralleling an earlier analysis of geographic clades among HHV-8 variants through sequencing of three PCR amplicons from each (40, 41). Intriguingly, the HHV-8 studies found only 1.5% sequence variation between the two most divergent geographic clades, whereas the east and west Pacific FPTHV sequence groups diverge by 4.6%, including 45 consistent substitutions that alter the identity of the encoded amino acid. This more-extensive divergence could reflect greater isolation among turtle populations than human ones.
A surprising finding of this analysis was the strikingly high degree of sequence conservation among FPTHVs infecting different marine turtle species. Only eight nucleotide substitutions in these loci separate the Australian green and loggerhead FPTHVs. The Costa Rica olive ridley variant, likewise, was substantially similar to FPTHVs infecting green turtles in the same geographic area, although there is one string of 21 contiguous substitutions (3 nonsynonymous) unique to the olive ridley sample. Whether this represents species-specific selection or defines another geographic group as discussed above remains to be investigated. It was initially expected that host species would be at least as important a factor as geography for virus sequence variation. The possibility remains that interspecies FPTHV differences exist but are clustered in genes which have not yet been sequenced. However, the idea that the same virus could infect multiple marine turtle species is not implausible. Reptilian lineages have been found to diverge from one another at significantly (perhaps eightfold) lower rates than mammalian ones (1, 4). Most of the seven marine turtle species are able to mate and produce viable hybrid offspring (6, 15, 37), indicating that they share substantial genetic similarity. Further FPTHV sequencing and a larger cross-species sample set will be required to resolve this issue.
Dating FPTHV in marine turtles. The existence of consistent geographic sequence variations in FPTHV make it clear that this infection was established in marine turtle populations prior to the start of the current FP epizootic 70 years ago. We hypothesize that FPTHV is in fact an ancient virus that was established in marine turtle populations prior to the rise of the Isthmus of Panama (circa 3 million years ago). However, it is currently difficult for a number of reasons to determine the evolutionary "age" of FPTHV. The slow divergence of reptilian lineages mentioned above complicates estimates of the timing of virus introduction to a population and raises questions about the validity of applying evolutionary clock analyses developed for mammalian lineages. Further uncertainties complicate the development of evolutionary clocks for herpesviruses specifically. For example, the VZV nucleotide substitution rate appears to be an order of magnitude lower than that of HSV-1, likely due to the lower replication rate and/or longer latency period of VZV (26). Nothing is currently known about the rate of FPTHV replication or length of latency in marine turtles. As a result of these complications and the lack of complete genome data, it is unlikely that any meaningful estimate of the duration of this virus-host relationship can be made at this time.
FPTHV geographic variation: the cause of FP variation? It is tempting to hypothesize that the regional sequence variations uncovered here are involved in the observed geographic variation in FP outcome (reviewed in reference 14). The existence of various geographic FPTHV clades opens the possibility that viral genetic factors are involved in, for example, the high FP mortality rate observed in the Indian River Lagoon in Florida and not in the San Diego Bay in California (23). On the other hand, local variations in FP incidence and severity have been observed even within the geographic clade areas studied here: FP is nearly absent along the Florida coast adjacent to the Indian River Lagoon (12). It thus seems likely that environmental factors, particularly water pollutants, play a role in FP pathogenesis. However, a number of characteristics of the marine turtle host complicate the differentiation of virus genetic versus environmental factors in FP. One complication concerns the largely unknown but far-reaching migration patterns of marine turtles: juveniles spend six or more years in a pelagic (ocean-faring) state, sometimes traveling between continents, and efforts to track their movements and risk factors during this time are just beginning (3). In addition, there are not yet precise genetic definitions of the turtle stocks nesting at different sites.
It has been suggested that FPTHV infection is acquired when turtles return to their natal feeding-nesting sites (38). The phylogeographic data presented here would appear to be in agreement with this hypothesis, since nesting site was the greatest variable observed. LETV, another herpesvirus of marine turtles, has been shown to be highly stable in salt water, suggesting that FPTHV infection could be waterborne (7). Waterborne infection would be expected to be more efficient in embayments where turtles congregate than in the open ocean. Similarly, the coastal organism Ozobranchus, a marine leech that parasitizes turtles, has recently been shown to harbor FPTHV DNA associated with particles of the density of enveloped viruses; this leech thus may act as a vector for FPTHV (10).
In summary, we have presented evidence that FPTHV, a factor in the etiopathology of marine turtle fibropapillomatosis, is an alphaherpesvirus but not a member of any of the currently established genera. Phylogenetic analysis indicates that FPTHV is long established as a marine turtle virus, carrying sequence variations unique to the geographic locations of its hosts. The 23-kb FPTHV contig presented here will serve as a basis for further work modeling virus-associated tumorigenesis and eventually for managing the FP syndrome in endangered turtle populations.
R.J.G. was supported by a fellowship from an NIH-NIEHS training grant, 2T32 ES07052-26.
Supplemental material for this article may be found at http://jvi.asm.org/. ![]()
Present address: Department of Microbiology & Immunology, State University of New York Upstate Medical University, Syracuse, NY 13210. ![]()
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»