Previous Article | Next Article 
Journal of Virology, February 2001, p. 1265-1273, Vol. 75, No. 3
0022-538X/01/$04.00+0 DOI: 10.1128/JVI.75.3.1265-1273.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.
Hepatitis C Virus Envelope Protein E2 Does Not
Inhibit PKR by Simple Competition with Autophosphorylation Sites in
the RNA-Binding Domain
Deborah R.
Taylor,1,2,3
Bin
Tian,4
Patrick R.
Romano,5,
Alan G.
Hinnebusch,5
Michael M. C.
Lai,3 and
Michael B.
Mathews1,4,*
Cold Spring Harbor Laboratory, Cold Spring Harbor, New York
117241; Genetics Program, State
University of New York at Stony Brook, Stony Brook, New York
117942; Department of Molecular
Microbiology and Immunology, Howard Hughes Medical Institute,
University of Southern California School of Medicine, University of
Southern California, Los Angeles, California
900333; Department of Biochemistry and
Molecular Biology, New Jersey Medical School, University of
Medicine and Dentistry of New Jersey, Newark, New Jersey
071034; and Laboratory of Eukaryotic
Gene Regulation, National Institute of Child Health and Human
Development, Bethesda, Maryland 208925
Received 15 August 2000/Accepted 31 October 2000
 |
ABSTRACT |
Double-stranded-RNA (dsRNA)-dependent protein kinase PKR is induced
by interferon and activated upon autophosphorylation. We previously
identified four autophosphorylated amino acids and elucidated their
participation in PKR activation. Three of these sites are in the
central region of the protein, and one is in the kinase domain. Here we
describe the identification of four additional autophosphorylated amino
acids in the spacer region that separates the two dsRNA-binding motifs
in the RNA-binding domain. Eight amino acids, including these
autophosphorylation sites, are duplicated in hepatitis C virus (HCV)
envelope protein E2. This region of E2 is required for its inhibition
of PKR although the mechanism of inhibition is not known. Replacement
of all four of these residues in PKR with alanines did not dramatically
affect kinase activity in vitro or in yeast Saccharomyces
cerevisiae. However, when coupled with mutations of serine 242 and threonines 255 and 258 in the central region, these mutations
increased PKR protein expression in mammalian cells, consistent with
diminished kinase activity. A synthetic peptide corresponding to this
region of PKR was phosphorylated in vitro by PKR, but phosphorylation was strongly inhibited after PKR was preincubated with HCV E2. Another
synthetic peptide, corresponding to the central region of PKR and
containing serine 242, was also phosphorylated by active PKR, but E2
did not inhibit this peptide as efficiently. Neither of the PKR
peptides was able to disrupt the HCV E2-PKR interaction. Taken
together, these results show that PKR is autophosphorylated on serine
83 and threonines 88, 89, and 90, that this autophosphorylation may
enhance kinase activation, and that the inhibition of PKR by HCV E2 is
not solely due to duplication of and competition with these
autophosphorylation sites.
 |
INTRODUCTION |
Hepatitis C virus (HCV) is an
emerging pathogen of increasing medical significance. As many as 2% of
the world population may now be infected with HCV, and possibly 90% of
these individuals will become chronically infected (14).
The only approved therapies for HCV are alpha interferon (IFN-
)
monotherapy or combination therapy with ribavirin. IFN is only
effective in about 10% of patients, but in these patients a
sustained response is accompanied by clearance of viral RNA. Genotypic
variants display different rates of response to IFN-
, and these
genotypes are characterized by mutations that may be responsible for
IFN-
resistance or sensitivity (12). Two HCV proteins
that have been implicated in IFN resistance through inhibition of the
IFN-
-induced, double-stranded-RNA (dsRNA)-activated protein kinase
(PKR) are NS5A and E2 (19, 52). The nonstructural protein,
NS5A, contains mutations in a region known as the
IFN-
-sensitivity-determining region in Japanese isolates; these
mutations result in a lack of PKR binding to NS5A and thus IFN-
sensitivity (for a review, see reference 50). E2 contains
a region of identity with PKR and its substrate, eIF2
, termed the
PKR-eIF2
phosphorylation site homology domain or PePHD; although the
exact mechanism is unknown, this region is required for PKR inhibition
(52).
PKR is a serine/threonine kinase found in cells in a latent state. It
plays a part in cellular antiviral defense as well as in apoptosis,
signal transduction, and transformation (reviewed in references
10, 24, 38, and 56). PKR is activated by autophosphorylation upon binding to its regulator, dsRNA, and similar
molecules (24, 38). Activation apparently occurs by an
intermolecular autophosphorylation reaction (26, 55),
permitting the enzyme to phosphorylate its substrates. Best known of
these is translational initiation factor eIF2, which is phosphorylated on serine 51 of its
subunit (15, 39). Phosphorylation
of eIF2
mediates a number of cellular processes, most notably the shutoff of protein synthesis (reviewed in references 10,
24, and 56). PKR also phosphorylates several
cellular and viral proteins, including the human immunodeficiency virus
transactivator protein, Tat (5, 34), and 90-kDa proteins
from rabbit reticulocytes (40) and human cells (8,
53; L. Parker, I. Fierro-Monti, and M. B. Mathews,
unpublished data). PKR mediates the phosphorylation of I
B, the
inhibitor of NF-
B (27, 32, 36), in response to dsRNA
although the role of PKR in this pathway is unclear (4). Phosphorylation of I
B enables NF-
B to translocate to the nucleus, and both NIK and IKK are components in this pathway (reviewed in
reference 2). Transgenic mice devoid of functional PKR are unresponsive to activators of NF-
B, further supporting the role of
PKR in signal transduction pathways (28). The roles of the other phosphorylation events are as yet unknown.
In addition to PKR, three other kinases can regulate protein synthesis
through phosphorylation of eIF2 (7, 22, 44). In
reticulocytes, the heme-regulated inhibitor, HRI, controls protein
synthesis levels in response to the availability of heme (7). The yeast Saccharomyces cerevisiae
regulates amino acid biosynthesis through translational derepression of
transcriptional activator GCN4 via GCN2 kinase, and a homologue of the
yeast enzyme has recently been isolated in Drosophila
melanogaster (22). Recently described eIF2 kinase
PERK or PEK is responsible for reduced protein synthesis during
endoplasmic reticulum stress (44).
PKR has homology with these kinases in its catalytic domain, which
occupies the C-terminal half of the protein. The N-terminal one-third
of PKR appears to function as its regulatory domain and has homology
with other dsRNA-binding proteins (6, 21, 25, 49). The
RNA-binding domain (RBD) of PKR consists of two repeats of a 65- to
68-amino-acid-long motif, the dsRNA-binding motif (dsRBM); these
repeats are rich in basic amino acids (17). The repeats,
dsRBM-1 and dsRBM-2 (amino acids 11 to 77 and 101 to 167, respectively), are separated by a short unstructured spacer (6,
16, 20, 21, 23, 35, 37, 43, 49). The spacer region is important
for RNA binding, as a mutant with a large deletion within this region
fails to bind RNA efficiently (21), possibly because of
structural constraints between dsRBM-1 and dsRBM-2. Separating the RBD
from the kinase domain of PKR is the central region (amino acids 233 to
268), which is also rich in basic amino acids but which is not
homologous to the dsRBMs.
Four sites of autophosphorylation in PKR have been described (42,
51), out of a total of 14 sites that may be phosphorylated in
vivo in yeast (58). Three of these sites are located in
the central region and participate in activation of the kinase. These sites were identified through peptide mapping and sequencing of PKR
phosphorylated during activation by dsRNA in vitro. The fourth and
possibly fifth sites of autophosphorylation were identified through
mass spectrometry and genetic analysis (42). These sites are located in the activation loop within the kinase domain and play a
role in kinase activation. Here we describe the identification of four
prominent autophosphorylation sites that are located in the spacer
region between the two dsRBMs in the RBD. Mutagenesis of these four
autophosphorylation sites did not affect enzyme activation in yeast or
in vitro or the binding of dsRNA but led to decreased PKR expression in
mammalian cells when combined with mutations of other
autophosphorylation sites in the central region of PKR. These results
suggest that phosphorylation of serine 83 and threonines 88, 89, and 90 contribute to full activation of the kinase. Eight amino acids in the
sequence containing these phosphorylation sites are identical to
residues in the HCV E2 protein. HCV E2 inhibited the phosphorylation of
PKR peptides, particularly that of the peptide that corresponds to the
homologous region in the spacer. The PKR peptides did not effectively
compete with HCV E2 for binding to PKR, however, suggesting that the
inhibition of PKR is not due to simple competition at these
autophosphorylation sites.
 |
MATERIALS AND METHODS |
Generation of radiolabeled peptides.
PKR, purified to the
mono-S stage from IFN-
-treated 293 cells (26), was
activated in vitro in the presence of reovirus dsRNA (provided by A. Shatkin) and [
-32P]ATP under conditions described
previously (51). Radiolabeled PKR was immunoprecipitated
with a polyclonal antibody (21) and was eluted from
protein A-Sepharose beads with formic acid, digested with cyanogen
bromide (CNBr) as described previously (51), and lyophilized. The CNBr digestion products were separated by
high-performance liquid chromatography (HPLC) (51),
fractions were collected and counted by Cerenkov radiation, and the
radioactive peaks were pooled. Radiolabeled peptides were resolved in
Tris-Tricine gels (47); the gels were fixed, dried, and
exposed to film for autoradiography.
Secondary peptidase digestion.
Secondary digestion of
radiolabeled PKR peptides was performed with the following enzymes:
endoproteinases Lys-C, Asp-N, and Arg-C (sequencing grade; Boehringer
Mannheim); trypsin (tolylsulfonyl phenylalanyl chlomethyl ketone
treated; Sigma); chymotrypsin (TLCK [N
-p-tosyl-L-lysine chloromethyl
ketone] treated; Sigma); and Staphylococcus aureus V8
(Sigma). Digestion with Arg-C was conducted in accordance with the
manufacturer's specifications, and digestion with Lys-C, Asp-N,
trypsin, and chymotrypsin was performed as described previously for
Lys-C (51).
Radioactive sequence analysis.
Secondary digests were
lyophilized, resuspended in 60% acetonitrile, and coupled to
arylamine-derivatized polyvinylidene difluoride (PVDF) membranes
(Sequalon AA; Millipore) with carbodiimide. PVDF-bound peptides were
subjected to repetitive Edman degradation reactions on a protein
sequencer (Applied Biosystems; 473A) (45), and radioactivity was monitored as described above.
Kinase assays.
For peptide phosphorylation kinetics and
phosphoamino acid analysis, mono S-purified PKR (26) was
added to a kinase reaction mixture (51) and the mixture
was incubated with dsRNA and [
-32P]ATP at 30°C for
20 min. For preincubation assays, peptides were incubated with PKR
before addition of dsRNA and ATP. Peptide P1 consists of amino acids 77 to 113 of PKR: H-KEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKR-OH. Peptide P2 consists of amino acids 230 to 254 of PKR:
H-NGLRNNQRKAKRSLAPRFDLPDMKE-OH. Incubations were conducted
at 30°C for 20 min unless otherwise specified, and peptides were
analyzed in sodium dodecyl sulfate (SDS)-20% polyacrylamide gels,
which were fixed, dried, and exposed to Kodak XAR-5 film for
autoradiography. Phosphoamino acid analysis was performed as described
previously (51). For assays with PKR from yeast, extracts
were prepared from H1817 cultures induced with synthetic minimal medium
containing 10% galactose and 2% raffinose as described
previously (51) and protein concentrations were determined
using a Coomassie blue dye-binding assay (Bio-Rad). Yeast extracts (50 µg of protein) were immunoprecipitated with a polyclonal anti-PKR
antibody (21) and protein A-Sepharose. The
immunoprecipitates were washed and then incubated as described above.
To assay eIF2 phosphorylation, eIF2 was added after the initial
incubation (as described in reference 33) and incubation resumed for another 20 min at 30°C.
Mutagenesis.
Sites of autophosphorylation were mutated by
the oligonucleotide-directed site-specific mutagenesis procedure
(1, 60). Serine and threonine residues were changed to
alanine to generate RBD mutant S83A/T88A/T89A/T90A, triple mutant
S242A/T255A/T258A (51), and combination mutant Tri-RBD,
which has all seven sites changed to alanine. Mutations were made in
pUC19D (21), which contains the full-length PKR cDNA.
PKR expression in S. cerevisiae.
PKR mutants
were subcloned into pEMBLyex4 as described previously
(43). Plasmids bearing the autophosphorylation site
mutations were introduced into yeast strains H1816 and H1817
(13), which both have GCN2 deleted; in addition, H1817 has
mutant eIF2
(S51A).
Phosphatase treatment.
Total cellular protein extracts (15 µg) from transformed H1817 cells were treated with lambda phosphatase
in accordance with the manufacturer's specifications (New England
Biolabs) or were incubated in phosphatase buffer alone and were
resolved in SDS-10% polyacrylamide gels. The proteins were then
transferred to nitrocellulose for Western blotting. The membrane was
incubated in 5% nonfat milk in Tris-buffered saline-Tween 20 (51) and probed with a monoclonal anti-PKR antibody
(30), and the proteins were visualized by
chemiluminescence (ECL; Amersham).
PKR expression in mammalian cells.
PKR mutants were
subcloned into pcDNA3 (Invitrogen). Monolayers of COS1 cells in
10-cm-diameter plates were transfected in duplicate with plasmids (15 µg) bearing the autophosphorylation site mutations, as well as a
transfection efficiency control, by the calcium phosphate method
(46). Cytoplasmic extracts were prepared at 48 h
posttransfection, and total protein concentration was measured by a
Coomassie blue assay (Bio-Rad). To assess the amount of PKR protein
that was present in each sample, 100 µg of total protein was examined
by Western blotting as described above. The upper half of the blot was
probed with the PKR monoclonal antibody (30), and the
lower half of the blot was probed with an actin polyclonal antibody
(Santa Cruz Biotechnology).
HCV E2 peptide phosphorylation inhibition assay.
PKR from
yeast H1817 strain was autophosphorylated as in the kinase assay
described above. Glutathione-coated Sepharose beads were used to purify
bacterially expressed glutathione S-transferase (GST)
protein or GST fused to the HCV E2 protein as described previously
(52). The protein was eluted with glutathione, and 0.5 µg was incubated with the immunoprecipitated PKR initially for 20 min
at 30°C. Poly(I:C) and [
-32P]ATP were added, and the
incubation continued for another 10 min. Then peptide (3 µg) P1
or P2 was added, and incubation continued for an additional 10 min at
30°C. The reactions were analyzed as described above.
HCV E2 binding and peptide competition assay.
Histidine-tagged PKR was bound to nickel-Sepharose beads as described
previously (52). HCV E2 was synthesized in vitro with the
T7 TNT-quick (Promega) coupled transcription-translation system in the
presence of [35S]methionine (New England Nuclear,
DuPont). Increasing amounts of synthetic peptide P1 or P2 were added to
the PKR-bound beads in 0.25 M Tris (pH 8.0)-0.1% NP-40-10 mM
imidazole. Radiolabeled E2 (5 µl of the in vitro translation reaction
mixture) was then added, and the mixture was incubated on ice for
2 h. The beads were washed five times in the incubation buffer
(increased to contain 0.3% NP-40). The last wash was removed, and
adherent labeled E2 protein was analyzed by gel electrophoresis and autoradiography.
 |
RESULTS |
Identification of PKR autophosphorylation sites.
To identify
the sites that are autophosphorylated when PKR is activated in vitro,
we labeled PKR with [
-32P]ATP in the presence of
reovirus dsRNA and then fragmented the protein with cyanogen bromide as
described previously (51). The predicted pattern of PKR
cleavage at methionine residues with cyanogen bromide is depicted in
Fig. 1A. Nine peptides ranging from 1.0 to 11.6 kDa are expected if cleavage is complete. The products were
separated by HPLC. Fractions were collected, counted by Cerenkov
radiation, and pooled as shown in Fig. 1B. Four major peaks, peaks A to
D, were obtained. Analysis of radioactive peaks A and B was reported
previously (51). When pool C, acquired from the most
prominent peak, was resolved in a Tris-Tricine gel, phosphorylated
peptides migrating with apparent molecular masses of 10.3 and 15.5 kDa
were observed together with a minor peptide at ~21 kDa (Fig. 1C, lane
2). Two of these peptides (15.5 and 21 kDa) probably represent partial
digestion products, as the largest peptide predicted after cyanogen
bromide digestion is 11.6 kDa (Fig. 1A) and secondary digestion of the
15.5-kDa peptide with cyanogen bromide yielded only a 10.3-kDa
radioactive peptide (data not shown).



View larger version (69K):
[in this window]
[in a new window]
|
FIG. 1.
CNBr digestion of PKR. (A) Sites of cleavage resulting
from CNBr digestion of PKR are predicted, based on the specificity of
CNBr, to cleave peptide bonds at the C-terminal side of methionine
residues. (B) Radiolabeled phosphopeptides derived by CNBr cleavage of
PKR were separated by reverse-phase HPLC. Fractions were collected and
assayed for radioactivity. (C) Radiolabeled peptides resulting from
CNBr cleavage of PKR were resolved in Tris-Tricine gels. Lane 1, digest
of 32P-PKR; lane 2: pool C. (D) Radioactive sequencing was
performed after secondary digestion with the proteases listed.
Radioactive peaks were obtained at the cycle numbers shown. The cycle
numbers containing the largest amounts of radioactivity are underlined
and in boldface. (E) Interpretation of the sequencing results. The
amino acid sequence of a PKR peptide (residues 69 to 90) is shown.
Arrows, protease recognition sites within the peptide for proteases
Lys-C, trypsin, chymotrypsin, and V8. Numbers were obtained from
analysis of Edman degradation reactions shown in panel D. *,
autophosphorylated amino acids.
|
|
Phosphoamino acid analysis demonstrated that both phosphoserine and
phosphothreonine were present in the 15.5- and 10.3-kDa bands
(51). Pool D contained similar peptides, although the 10.3-kDa peptide was relatively less abundant (51), and
pools C and D gave identical results upon subsequent analysis. A
10.3-kDa peptide was also released by cyanogen bromide treatment of
phosphorylated p20, a subfragment of PKR containing residues 1 to 184 (data not shown). As reported previously, recombinant p20 can be
phosphorylated by PKR (48). This finding suggested that
the 10.3-kDa peptide comes from the dsRNA-binding domain of PKR.
No peaks of radioactivity were released upon the direct sequencing of
the material in pools C or D. Radioactivity did remain bound to the
filter, however, indicating that the N terminus of this peptide was
blocked or that the phosphoamino acids were located past the point of
efficient sequencing (~25 to 30 amino acids). To test the latter
possibility, material in the two pools was subjected to secondary
digestion with one or two of six specific proteases. The positions of
labeled amino acids were identified by counting the radioactivity of
the products of sequential Edman degradation reactions. Radioactive
peaks were obtained, and the results are tabulated in Fig. 1D. A
summary of the sequencing data is shown in Fig. 1E. Comparison with the
PKR sequence indicated that serine 83 and one or more of threonines 88, 89, and 90 were phosphorylated.
Several factors make it difficult to discriminate unambiguously among
the three threonine residues, most notably the occurrence of multiple
neighboring cleavage sites and the propensity of the proteases for
partial cleavage. Two of the proteases used for secondary digestion
recognize lysine (trypsin, Lys-C) or leucine (chymotrypsin), and
incomplete digestion products were obtained because of the presence of
two lysines and three leucines just upstream of the phosphorylation
site (Fig. 1E). These proteases cleave at the C-terminal side of amino
acids in a peptide, and in a run of identical residues they tend to
cleave preferentially between the residues rather than after them. Thus
the C-terminal residue in the run may not be recognized by the
protease, leaving that amino acid on the N terminus and causing a shift
or "stuttering" in the profiles of radioactivity obtained after
Edman degradation reactions. Nevertheless, detailed examination of the
profiles suggested that threonines 88, 89, and 90 are all
phosphorylated. In radioactive sequencing experiments of this kind, a
declining trail of radioactivity is generally observed in the Edman
degradation cycles that follow the position of the radiolabeled amino
acid. The pattern of increased yield followed by some carryover or
"lag" derivatives (due to incomplete release of the phosphoamino
acid derivative from the filter) is often used as a criterion to assess whether the yield of the phosphoamino acid is significantly greater than background. In the sequencing reactions of pools C and D with
chymotrypsin, V8, and Lys-C (Fig. 1D), however, the radioactive peaks
corresponding to the first threonine position were followed by two
higher peaks, corresponding to the second and third threonine, and then
a trail of radioactivity, indicating that all three threonines are
phosphorylated. Thus we conclude that four residues, serine 83 and
threonines 88, 89, and 90, located in the spacer between the two
dsRBMs, are probably all phosphorylated.
Phosphorylation of PKR peptides in vitro.
To corroborate the
sequencing data, we tested two synthetic peptides corresponding to the
RBD spacer region (P1; amino acids 77 to 113) and the central region of
PKR surrounding serine 242 (P2; amino acids 230 to 254). Both P1 and P2
were phosphorylated efficiently by PKR (Fig.
2A and B), verifying that they are
substrates for phosphorylation by PKR and that these sites can be
recognized by intermolecular phosphorylation. Phosphoamino acid
analysis (Fig. 2C) revealed that P1 is labeled on both the serine and
the threonine residues whereas P2 is labeled on serine only, as
expected. The phosphorylation of P1 and P2 continued after PKR
autophosphorylation reached saturation (Fig. 2B); under these
conditions, neither of the peptides interfered with PKR
autophosphorylation (data not shown), suggesting that they do not
compete effectively with the activation reaction.

View larger version (38K):
[in this window]
[in a new window]
|
FIG. 2.
Phosphorylation of peptides by PKR. (A) Kinetics of
peptide phosphorylation. Reactions were stopped at different time
points (a, 0 min; b, 4 min; c, 8 min; d, 16 min; e, 28 min; f, 44 min;
g, 66 min; h, 108 min; I, 133 min; j, 190 min). (B) Quantitation of PKR
autophosphorylation and peptide phosphorylation. Data from panel A are
presented as percentages of maximal 32P labeling. , P1
phosphorylation; , PKR phosphorylation in the presence of P1; ,
P2 phosphorylation; , PKR phosphorylation in the presence of P2. (C)
Phosphorylated peptides were subjected to phosphoamino acid analysis by
hydrolysis, two-dimensional separation, and autoradiography. Positions
of markers, detected by ninhydrin staining, are circled.
|
|
Autophosphorylation sites in the RNA-binding domain do not affect
PKR function in yeast.
To examine the significance of the four
autophosphorylation sites in the RBD spacer, the serine and three
threonine residues were all changed to alanine (Fig.
3A). This PKR RBD mutant
(S83A/T88A/T89A/T90A) was tested in yeast together with wild-type PKR
and three other mutants: K296R, which is inactive as a result of a
mutation in the ATP-binding/phosphotransfer site (23);
Triple mutant S242A/T255A/T258A, which is partially inactivated by
three mutations in the central region (51); and Tri-RBD,
which contains all seven of the mutations in the Triple and RBD
mutants.

View larger version (25K):
[in this window]
[in a new window]
|
FIG. 3.
PKR mutations and yeast growth. (A) Schematic of PKR
autophosphorylation site mutations. Serine and threonine residues were
changed to alanine to generate Triple and RBD mutants and the
combination mutant; Tri-RBD, which has all seven sites changed to
alanine. (B) Results of yeast growth assays. Transformed cells (H1816)
were grown on SD medium and were replica plated to SGAL and SD+3AT
medium for growth analysis (43). +, strong growth; ±,
slow growth; , no growth.
|
|
Transformants of yeast strain H1816, which carries a wild-type eIF2
allele, were grown on selective media to analyze mutant kinases for
their activity (13). Yeast cells that express fully active
PKR cannot grow on galactose medium (SGAL) due to overexpression of PKR
(driven by the Gal promoter) and consequent phosphorylation of eIF2
.
In contrast, expression of PKR at much lower levels on
dextrose-containing medium allows cells to grow in the presence of
3-aminotriazole (SD+3AT), an inhibitor of histidine biosynthesis, because a moderate level of eIF2 phosphorylation allows for GCN4 translation (Fig. 3B). Cells transformed with inactive PKR mutants, such as K296R, grow on both synthetic minimal dextrose (SD) and SGAL
media but not on SD+3AT (Fig. 3B). The phenotype of yeast cells
transformed with the RBD mutant was indistinguishable from that of
cells transformed with wild-type PKR, suggesting that the RBD mutant is
fully active. Furthermore, the slow-growth phenotype conferred by the
Triple mutant in SD+3AT medium (51) was not exacerbated in
the Tri-RBD mutant (Fig. 3B). This slow-growth phenotype is
attributable to mutations in the central region, most notably T258A,
which is important to the activation of PKR (51). These
data indicate that phosphorylation of residues in the RBD spacer is not
required for PKR function in yeast cells.
Phosphorylation state of PKR in vivo.
To determine
specifically whether these residues are required for
autophosphorylation of PKR in vivo, yeast strain H1817 was transformed
with wild-type or mutant forms of PKR. This strain contains the S51A
mutation of eIF2
, allowing for high expression of both active and
inactive PKR (13). The yeast was grown under inducing
conditions (43), and extracts were treated with lambda phosphatase or were incubated with phosphatase buffer alone. These extracts were then resolved in an SDS gel, transferred to
nitrocellulose, and probed with monoclonal anti-PKR antibody.
Wild-type PKR showed a distinct increase in gel mobility upon
phosphatase treatment (Fig. 4A), as
observed previously (42). Catalytically inactive mutant
K296R migrated with the phosphatase-treated form and showed no shift in
mobility upon phosphatase treatment, indicating that yeast does not
contain endogenous kinases that phosphorylate PKR. When the Tri-RBD
mutant, carrying seven alanine substitutions, was treated with
phosphatase, it showed a small but reproducible shift in mobility (Fig.
4A), indicating that the mutant kinase is phosphorylated to some extent
in vivo. This conclusion was confirmed by labeling with 32P
in vivo and analysis of peptides derived by cyanogen bromide cleavage.
Consistent with the removal of the seven sites of phosphorylation in
the RBD and central region, phosphopeptides of 3.5, 10.3, and 15.5 kDa
were missing. The digest did, however, yield the 21-kDa peptide and a
peptide migrating faster than 10 kDa (data not shown), presumably
attributable to sites in the activation loop of the kinase domain
(42) or to other potential phosphorylation sites reported
previously (58).

View larger version (27K):
[in this window]
[in a new window]
|
FIG. 4.
Properties of PKR mutants. (A) PKR phosphorylation
state. Total cellular protein extracts from transformed H1817 cells
were treated with lambda phosphatase (+) or phosphatase buffer alone
( ), resolved in SDS-10% polyacrylamide gels, and analyzed by
Western blotting with a monoclonal anti-PKR antibody (30)
and chemiluminescence detection. wt, wild type. (B) Kinase activity.
Autophosphorylation of wild-type and mutant PKR and phosphorylation of
eIF2 were conducted in vitro. Kinase assay mixtures contained PKR,
isolated on antibody-coated beads, in the presence (+) or absence ( )
of eIF2. Detection was by gel electrophoresis and autoradiography.
|
|
PKR kinase activity in vitro.
Although these assays suggested
that the RBD mutation did not affect kinase activity or
autophosphorylation in yeast, we wanted to measure the activities of
the mutant kinases directly. PKR was isolated by immunoprecipitation
from extracts of H1817 strains carrying mutant or wild-type forms of
the enzyme. The amount of PKR protein recovered was normalized by
immunoblotting (as shown in Fig. 4A), and its activity was assessed in
kinase assays. Figure 4B shows that wild-type PKR was active for
autophosphorylation and for phosphorylation of eIF2
, while K296R was
inactive in both respects. The Triple mutant was weakly active, and
S242A was highly active, as expected from published results
(51). Consistent with the in vivo data, the RBD mutations
alone did not affect PKR autophosphorylation or the phosphorylation of
eIF2
and modestly exacerbated the effects of the Triple mutation
when the mutations were present together in Tri-RBD (Fig. 4B). Thus, the RBD sites influence kinase activity modestly in vitro.
In view of their location, we also considered the possibility that the
RBD phosphorylation sites might play a role in RNA binding. To address
this possibility, we measured the ability of immobilized PKR, isolated
by immunoprecipitation from yeast as described above, to interact with
32P-labeled synthetic dsRNA. Mutations in the RBD did not
significantly alter the retention of dsRNA by PKR (data not shown).
Expression of PKR mutants in mammalian cells.
To examine the
effect of the RBD mutations in mammalian cells, we measured the levels
of mutant PKR during transient expression assays (Fig.
5). Cytoplasmic extracts were prepared
from transfected COS1 cells, and equal amounts of total proteins were
resolved in a gel; PKR expression was monitored by Western blotting.
Plates were transfected in duplicate, and the immunoblot was probed
with antibodies against human PKR (top) and actin (bottom). As observed previously (42, 54) PKR mutant K296R was expressed at a
much higher level than wild-type PKR, indicating that this mutant is unable to down-regulate its expression because it is inactive. Both the
Triple and RBD mutants were expressed at very low levels, indicating
that these mutants are active. The Tri-RBD mutant, however, was
expressed at an intermediate level, lower than that for K296R but
higher than those for the other mutants, indicating that this mutant is
less active than either the Triple or RBD mutant but not as inactive as
K296R. Thus, the RBD sites contribute to, but are not essential for,
the activity of the kinase.

View larger version (33K):
[in this window]
[in a new window]
|
FIG. 5.
Expression of PKR mutants in mammalian cells. COS1 cells
were transfected in duplicate with plasmids encoding wild-type (WT) or
mutant PKR together with pEGFP-C1 (Clontech) encoding green fluorescent
protein. Transfection efficiency was monitored by observing the ratio
of green fluorescent cells to the total number of cells. Protein
expression was monitored by immunoblotting with a PKR monoclonal
antibody (30) and an antiactin antibody.
|
|
Peptide competition and HCV E2 inhibition.
We previously
showed that HCV E2 binds to PKR and inhibits its kinase activity, as
measured by its ability both to become autophosphorylated and to
phosphorylate a histone H2a substrate (52). To determine
whether HCV E2 can inhibit phosphorylation of peptides corresponding to
its autophosphorylation sites, activated PKR was incubated with E2 in a
kinase assay containing P1 or P2. Figure
6A shows that GST-E2 efficiently blocked
the phosphorylation of peptide P1 (lane 6). The phosphorylation of P2
was also inhibited but to a lesser extent (lane 7), but GST protein did
not significantly inhibit P1 or P2 phosphorylation (lanes 3 and 4). As
discussed previously (52), GST-E2 did not affect PKR
autophosphorylation in this system due to its preactivation state.

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 6.
HCV E2 competition with PKR autophosphorylation site
peptides. (A) Kinase assay mixtures contained PKR immunoprecipitated
from yeast extracts. PKR was incubated with GST or GST-E2 proteins and
peptide P1 or P2 before adding [32P]ATP. Incorporation of
32P into PKR and peptides was monitored by gel
electrophoresis and autoradiography. (B) E2 binding assays. Nickel
nitrilotriacetic acid-agarose-bound histidine-tagged PKR was incubated
with peptide P1 (1, 5, 15, and 60 mg/ml [lanes 2 to 5]) or peptide P2
(0.6 and 2.4 mg/ml [lanes 6 and 7]) or without added peptide (lane 1)
and then with 35S-labeled E2 protein. Binding was monitored
by gel electrophoresis and autoradiography.
|
|
Deletion of or mutations in the PePHD in HCV E2 abrogate its functional
interaction with PKR (52). We therefore tested the ability
of the two PKR peptides to interfere with the binding of E2 to PKR. As
shown in Fig. 6B, the interaction between PKR and HCV E2 was not
blocked by either peptide P1 or P2. Concentrations of P1 as high as 60 mg/ml failed to prevent the binding of E2 to PKR. Thus E2 is a strong
ligand for PKR and can compete with substrates that are
trans-autophosphorylation sites, but it is not displaced
from PKR by high concentrations of peptide substrates corresponding to
these sites.
 |
DISCUSSION |
PKR is found in most mammalian cells at a low level, and
expression of the enzyme is induced by interferon. The kinase is activated by viral infection in cells and by binding to dsRNA in vitro
(33). Autophosphorylation on several serine and threonine residues, which accompanies activation (18, 29), is
believed to be instrumental in converting the enzyme to a state in
which it is able to phosphorylate its substrates including eIF2.
Previously we identified three autophosphorylation sites in the central
region of PKR and one or two sites in the kinase domain that
participate in the activation of the enzyme (42, 51).
These sites did not appear to be the most prominent autophosphorylation
sites in vitro, however (51). Data presented here identify
amino acids in the spacer region of the RBD, serine 83 and threonines
88, 89, and 90, as major sites of phosphorylation in vitro. Mass
spectrometry analysis of PKR isolated from yeast demonstrated that
phosphorylation of the same sites also occurs in vivo
(58).
The mutagenic analysis reported here suggests that the
autophosphorylation sites in the RBD are involved in, but are not
required for, kinase activation. This inference is supported by the
observation (31) that large deletions in the RBD did not
affect activation of the kinase when endogenous PKR was present. In
these experiments the activation of mutant PKR that could not become
activated through dsRNA binding (in the absence of the RBD) was
presumably brought about either through
trans-phosphorylation by endogenous PKR or by removal of an
autoinhibitory domain located in the RBD. Evidence in support of the
latter mechanism comes from the finding that deletions within the RBD
can lead to elevated kinase activity in vitro (57, 59).
These data imply the existence of a negative regulatory element in the
RBD; by extension, dsRNA binding may serve as a trigger to relieve the
inhibition (41).
In combination with sites in the central region of PKR, the RBD
autophosphorylation sites appear to play a role in activation of the
kinase in vitro and in mammalian cells. They do not affect kinase
activity to a detectable extent in the yeast growth assay, however,
where subtle changes in kinase activity or RNA-binding affinity may be
missed because of the abundance of dsRNA molecules in yeast. It is
possible that the small decrease in activity reflects a change in dsRNA
binding or release due to the additional negative charge provided by
the addition of phosphate groups to the RBD sites. Efficient activation
of PKR by dsRNA requires two dsRBMs and is adversely affected by a
large deletion in the spacer between them, although a small deletion
was tolerated (21). A recent structural study of the RBD
by nuclear magnetic resonance techniques indicates that the spacer
constitutes a flexible linker between the dsRBMs, allowing the RBD to
wrap around the dsRNA (35). Thus it is conceivable that
phosphorylation in the spacer limits this flexibility. Such constraints
might have several consequences for the specificity of RNA binding.
First, the constraints could restrict the size range of dsRNA molecules
that can interact with PKR; second, in view of the growing body of
evidence that PKR can be activated or blocked by molecules that are not
fully duplexed (3, 9), the constraints might impose
restrictions on the spectrum of partially duplexed RNAs that serve
these functions; third, they might aid in discriminating between
activators and inhibitors. Furthermore, it is possible that PKR may
need to dissociate from structures with which it interacts in vivo to
trans-phosphorylate substrates or other PKR molecules. Since
RBD phosphorylation does not reduce PKR's RNA-binding affinity
significantly, there is no evidence that it participates in the release
of PKR from dsRNA, but phosphorylation of PKR may influence its
functional interaction with ribosomes or its distribution or transport
between subcellular compartments.
We note that PKR is activated by autophosphorylation of the third basic
domain and the activation loop in the kinase domain (42,
51). Our finding that PKR can trans-phosphorylate
peptides that contain PKR autophosphorylation sites, even after PKR
autophosphorylation has reached saturation, indicates that these sites
(serine 242, serine 83, and threonines 88, 89, and 90) can be
phosphorylated through an intermolecular mechanism.
Together with the four to five sites identified previously (42,
51) the present work brings the total of PKR autophosphorylation sites identified to date to nine. Within this set, threonines outnumber serines by seven to two. Previous reports have demonstrated that PKR yields considerably more phosphoserine than phosphothreonine (29), so it seems likely that additional sites remain to
be characterized. The sequences surrounding the known
autophosphorylation sites are listed and aligned in Table
1. Among the PKR substrates, phosphorylation sites have been identified for the
subunit of eIF2
(39), for Tat (5), and for p53
(11); these sites are also included in Table 1.
Little homology is readily apparent among the sites, but, strikingly,
eight amino acids in the phosphorylated region of the RBD are identical
to residues in the HCV envelope protein, E2 (Table
2). Moreover, the homology extends
upstream. These observations led to the discovery that the E2 protein
from IFN-resistant strains of HCV is an inhibitor of and potential
substrate for PKR (52). Previously it was shown that HCV
E2 inhibits PKR autophosphorylation and substrate phosphorylation in
vitro (52). Here we show that HCV E2 binds efficiently to
PKR and that this interaction cannot be dissociated by a peptide (P1)
that contains the homologous PKR sequence, even though P1 contains
autophosphorylation sites and is a trans-phosphorylation
substrate. Nevertheless, phosphorylation of this peptide is efficiently
inhibited by E2, indicating that E2 is a potent inhibitor of PKR
autophosphorylation as well as substrate phosphorylation and that this
action is not carried out through a simple competitive mechanism. These
data imply that mimicry of the autophosphorylation site by HCV E2
contributes to its inhibition of PKR via a pseudosubstrate
mechanism. In addition, other regions of the E2 protein may also be
involved, possibly acting to stabilize the PKR-E2 interaction by
reducing the "off" rate. Thus, duplication of a major PKR
autophosphorylation site is part of the strategy evolved by HCV for
evading the effects of IFN, but further work is required to fully
uncover this aspect of the E2 protein's function.
 |
ACKNOWLEDGMENTS |
We thank Dan Marshak and Georgia Binns for help with peptide
analysis, Shobha Gunnery for helpful discussions, and Lisa Manche for
purification of PKR.
Bin Tian is in receipt of predoctoral fellowship 9810005T from the
American Heart Association. Deborah Taylor was supported by a
postdoctoral fellowship from the National Institute of Allergy and
Infectious Diseases, NIH. This study was supported by NIH grants AI
34552 and CA 13106 to M.B.M.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Department of
Biochemistry and Molecular Biology, New Jersey Medical School,
University of Medicine and Dentistry of New Jersey, Newark, NJ 07103. Phone: (973) 972-4411. Fax: (973) 972-5594. E-mail:
mathews{at}UMDNJ.edu.
Present address: Jefferson Center for Biomedical Research,
Doylestown, PA 18901-2697.
 |
REFERENCES |
| 1.
|
Ausubel, F. M.,
R. Brent,
R. E. Kingston,
D. D. Moore,
J. G. Seidman,
J. A. Smith, and K. Struhl (ed.).
1991.
Current protocols in molecular biology, 2nd ed., vol. 1.
John Wiley & Sons, New York, N.Y.
|
| 2.
|
Baeuerle, P. A., and D. Baltimore.
1996.
NF-kappa B: ten years after.
Cell
87:13-20[CrossRef][Medline].
|
| 3.
|
Bevilacqua, P. C.,
C. X. George,
C. E. Samuel, and T. R. Cech.
1998.
Binding of the protein kinase PKR to RNAs with secondary structure defects: role of the tandem A-G mismatch and noncontiguous helixes.
Biochemistry
37:6303-6316[CrossRef][Medline].
|
| 4.
|
Bonnet, M. C.,
R. Weil,
E. Dam,
A. G. Hovanessian, and E. F. Meurs.
2000.
PKR stimulates NF- B irrespective of its kinase function by interacting with the I B kinase complex.
Mol. Cell. Biol.
20:4532-4542[Abstract/Free Full Text].
|
| 5.
|
Brand, S. R.,
R. Kobayashi, and M. B. Mathews.
1997.
The Tat protein of human immunodeficiency virus type 1 is a substrate and inhibitor of the interferon-induced, virally activated protein kinase, PKR.
J. Biol. Chem.
272:8388-8395[Abstract/Free Full Text].
|
| 6.
|
Bycroft, M.,
S. Grünert,
A. G. Murzin,
M. Proctor, and D. St. Johnston.
1995.
NMR solution structure of a dsRNA binding domain from drosophila staufen protein reveals homology to the N-terminal domain of ribosomal protein S5.
EMBO J.
14:3563-3571[Medline].
|
| 7.
|
Chen, J.-J.
2000.
Heme-regulated eIF2a kinase, p. 529-546.
In
N. Sonenberg, J. W. B. Hershey, and M. B. Mathews (ed.), Translational control of gene expression. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 8.
|
Chou, J.,
J. Chen,
M. Gross, and B. Roizman.
1995.
Association of a Mr 90,000 phosphoprotein with protein kinase PKR in cells exhibiting enhanced phosphorylation of translation initiation factor eIF-2 and premature shutoff of protein synthesis after infection with 1-34.5 mutants of herpes simplex virus 1.
Proc. Natl. Acad. Sci. USA
92:10516-10520[Abstract/Free Full Text].
|
| 9.
|
Circle, D. A.,
O. D. Neel,
H. D. Robertson,
P. A. Clarke, and M. B. Mathews.
1997.
Surprising specificity of PKR binding to delta agent genomic RNA.
RNA
3:438-448[Abstract].
|
| 10.
|
Clemens, M. J.
1997.
PKR a protein kinase regulated by double-stranded RNA.
Int. J. Biochem. Cell Biol.
29:945-949[CrossRef][Medline].
|
| 11.
|
Cuddihy, A. R.,
A. H. Wong,
N. W. Tam,
S. Li, and A. E. Koromilas.
1999.
The double-stranded RNA activated protein kinase PKR physically associates with the tumor suppressor p53 protein and phosphorylates human p53 on serine 392 in vitro.
Oncogene
18:2690-2702[CrossRef][Medline].
|
| 12.
|
Davis, G. L., and J. Y. Lau.
1997.
Factors predictive of a beneficial response to therapy of hepatitis C.
Hepatology
26:122S-127S[CrossRef][Medline].
|
| 13.
|
Dever, T. E.,
L. Feng,
R. C. Wek,
A. M. Cigan,
T. F. Donahue, and A. G. Hinnebusch.
1992.
Phosphorylation of initiation factor 2 by protein kinase GCN2 mediates gene-specific translational control of GCN4 in yeast.
Cell
68:585-596[CrossRef][Medline].
|
| 14.
|
Di Bisceglie, A. M.
1998.
Hepatitis C.
Lancet
351:351-355[CrossRef][Medline].
|
| 15.
|
Farrell, P. J.,
K. Balkow,
T. Hunt,
R. J. Jackson, and H. Trachsel.
1977.
Phosphorylation of initiation factor eIF-2 and the control of reticulocyte protein synthesis.
Cell
11:187-200[CrossRef][Medline].
|
| 16.
|
Feng, G.-S.,
K. Chong,
A. Kumar, and B. R. G. Williams.
1992.
Identification of double-stranded RNA-binding domains in the interferon-induced double-stranded RNA-activated p68 kinase.
Proc. Natl. Acad. Sci. USA
89:5447-5451[Abstract/Free Full Text].
|
| 17.
|
Fierro-Monti, I., and M. B. Mathews.
2000.
Proteins binding duplexed RNA: one motif, multiple functions.
Trends Biochem. Sci.
25:241-246[CrossRef][Medline].
|
| 18.
|
Galabru, J., and A. Hovanessian.
1987.
Autophosphorylation of the protein kinase dependent on double-stranded RNA.
J. Biol. Chem.
262:15538-15544[Abstract/Free Full Text].
|
| 19.
|
Gale, M. J., Jr.,
M. J. Korth,
N. M. Tang,
S. L. Tan,
D. A. Hopkins,
T. E. Dever,
S. J. Polyak,
D. R. Gretch, and M. G. Katze.
1997.
Evidence that hepatitis C virus resistance to interferon is mediated through repression of the PKR protein kinase by the nonstructural 5A protein.
Virology
230:217-227[CrossRef][Medline].
|
| 20.
|
Green, S. R.,
L. Manche, and M. B. Mathews.
1995.
Two functionally distinct RNA binding motifs in the regulatory domain of the protein kinase DAI.
Mol. Cell. Biol.
15:358-364[Abstract].
|
| 21.
|
Green, S. R., and M. B. Mathews.
1992.
Two RNA binding motifs in the double-stranded RNA activated protein kinase, DAI.
Genes Dev.
6:2478-2490[Abstract/Free Full Text].
|
| 22.
|
Hinnebusch, A. G.
2000.
Mechanism and regulation of initiator methionyl-tRNA binding to ribosomes, p. 185-244.
In
N. Sonenberg, J. W. B. Hershey, and M. B. Mathews (ed.), Translational control of gene expression. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 23.
|
Katze, M. G.,
M. Wambach,
M.-L. Wong,
M. Garfinkel,
E. Meurs,
K. Chong,
B. R. G. Williams,
A. G. Hovanessian, and G. N. Barber.
1991.
Functional expression and RNA binding analysis of the interferon-induced, double-stranded RNA-activated, 68,000-Mr protein kinase in a cell-free system.
Mol. Cell. Biol.
11:5497-5505[Abstract/Free Full Text].
|
| 24.
|
Kaufman, R. J.
2000.
Double-stranded RNA-activated protein kinase PKR, p. 503-528.
In
N. Sonenberg, J. W. B. Hershey, and M. B. Mathews (ed.), Translational control of gene expression. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 25.
|
Kharrat, A.,
M. J. Macias,
T. J. Gibson,
M. Nilges, and A. Pastore.
1995.
Structure of the dsRNA binding domain of E. coli RNase III.
EMBO J.
14:3572-3584[Medline].
|
| 26.
|
Kostura, M., and M. B. Mathews.
1989.
Purification and activation of the double-stranded RNA-dependent eIF-2 kinase DAI.
Mol. Cell. Biol.
9:1576-1586[Abstract/Free Full Text].
|
| 27.
|
Kumar, A.,
J. Haque,
J. Lacoste,
J. Hiscott, and B. R. G. Williams.
1994.
Double-stranded RNA-dependent protein kinase activates transcription factor NF- B by phosphorylating I B.
Proc. Natl. Acad. Sci. USA
91:6288-6292[Abstract/Free Full Text].
|
| 28.
|
Kumar, A.,
Y. L. Yang,
V. Flati,
S. Der,
S. Kadereit,
A. Deb,
J. Haque,
L. Reis,
C. Weissmann, and B. R. Williams.
1997.
Deficient cytokine signaling in mouse embryo fibroblasts with a targeted deletion in the PKR gene: role of IRF-1 and NF-kappaB.
EMBO J.
16:406-416[CrossRef][Medline].
|
| 29.
|
Lasky, S. R.,
B. L. Jacobs, and C. E. Samuel.
1982.
Characterization of the sites of phosphorylation in the interferon-induced phosphoprotein P1 from mouse fibroblasts: evidence for two forms of P1.
J. Biol. Chem.
257:11087-11093[Abstract/Free Full Text].
|
| 30.
|
Laurent, A. G.,
B. Krust,
J. Galabru,
J. Svab, and A. G. Hovanessian.
1985.
Monoclonal antibodies to an interferon-induced Mr 68,000 protein and their use for the detection of double-stranded RNA-dependent protein kinase in human cells.
Proc. Natl. Acad. Sci. USA
82:4341-4345[Abstract/Free Full Text].
|
| 31.
|
Lee, S. B.,
S. R. Green,
M. B. Mathews, and M. Esteban.
1994.
Activation of the double-stranded RNA-activated human protein kinase in vivo in the absence of its dsRNA binding domain.
Proc. Natl. Acad. Sci. USA
91:10551-10555[Abstract/Free Full Text].
|
| 32.
|
Maran, A.,
R. K. Maitra,
A. Kumar,
B. Dong,
W. Xiao,
G. Li,
B. R. G. Williams,
P. F. Torrence, and R. H. Silverman.
1994.
Blockage of NF- B signaling by selective ablation of an mRNA target by 2-5A antisense chimeras.
Science
265:789-792[Abstract/Free Full Text].
|
| 33.
|
Maran, A., and M. B. Mathews.
1988.
Characterization of the double-stranded RNA implicated in the inhibition of protein synthesis in cells infected with a mutant adenovirus defective for VA RNAI.
Virology
164:106-113[CrossRef][Medline].
|
| 34.
|
McMillan, N. A.,
B. W. Carpick,
B. Hollis,
W. M. Toone,
M. Zamanian-Daryoush, and B. R. Williams.
1995.
Mutational analysis of the double-stranded RNA (dsRNA) binding domain of the dsRNA-activated protein kinase, PKR.
J. Biol. Chem.
270:2601-2606[Abstract/Free Full Text].
|
| 35.
|
Nanduri, S.,
B. W. Carpick,
Y. Yang,
B. R. Williams, and J. Qin.
1998.
Structure of the double-stranded RNA-binding domain of the protein kinase PKR reveals the molecular basis of its dsRNA-mediated activation.
EMBO J.
17:5458-5465[CrossRef][Medline].
|
| 36.
|
Offermann, M. K.,
J. Zimring,
K. H. Mellits,
M. K. Hagan,
R. Shaw,
R. M. Medford,
M. B. Mathews,
S. Goodbourn, and R. Jagus.
1995.
Activation of the double-stranded-RNA-activated protein kinase and induction of vascular cell adhesion molecule-1 by poly (I).poly (C) in endothelial cells.
Eur. J. Biochem.
232:28-36[Medline].
|
| 37.
|
Patel, R. C., and G. C. Sen.
1992.
Identification of the double-stranded RNA-binding domain of the human interferon-inducible protein kinase.
J. Biol. Chem.
267:7671-7676[Abstract/Free Full Text].
|
| 38.
|
Pe'ery, T., and M. B. Mathews.
2000.
Viral translational strategies and host defense mechanisms, p. 371-424.
In
N. Sonenberg, J. W. B. Hershey, and M. B. Mathews (ed.), Translational control of gene expression. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 39.
|
Proud, C. G.
1995.
PKR: a new name and new roles.
Trends Biochem. Sci.
20:241-246[CrossRef][Medline].
|
| 40.
|
Rice, A. R.,
M. Kostura, and M. B. Mathews.
1989.
Identification of a 90 KD polypeptide which associates with adenovirus VA RNAI and is phosphorylated by the double-stranded RNA dependent protein kinase.
J. Biol. Chem.
264:20632-20637[Abstract/Free Full Text].
|
| 41.
|
Robertson, H. D., and M. B. Mathews.
1996.
The regulation of the protein kinase PKR by RNA.
Biochimie
78:909-914[Medline].
|
| 42.
|
Romano, P. R.,
M. T. Garcia-Barrio,
X. Zhang,
Q. Wang,
D. R. Taylor,
F. Zhang,
C. Herring,
M. B. Mathews,
J. Qin, and A. G. Hinnebusch.
1998.
Autophosphorylation in the activation loop is required for full kinase activity in vivo of human and yeast eukaryotic initiation factor 2 kinases PKR and GCN2.
Mol. Cell. Biol.
18:2282-2297[Abstract/Free Full Text].
|
| 43.
|
Romano, P. R.,
S. R. Green,
G. N. Barber,
M. B. Mathews, and A. G. Hinnebusch.
1995.
Structural requirements for double-stranded RNA binding, dimerization, and activation of the human eIF-2 kinase DAI in Saccharomyces cerevisiae.
Mol. Cell. Biol.
15:365-378[Abstract].
|
| 44.
|
Ron, D., and H. P. Harding.
2000.
PERK and translational control by stress in the endoplasmic reticulum, p. 547-560.
In
N. Sonenberg, J. W. B. Hershey, and M. B. Mathews (ed.), Translational control of gene expression. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 45.
|
Russo, G. L.,
M. T. Vandenberg,
I.-J. Yu,
Y.-S. Bae,
B. R. Franza, Jr., and D. R. Marshak.
1992.
Casein kinase II phosphorylates p34cdc2 kinase in G1 phase of the HeLa cell division cycle.
J. Biol. Chem.
267:20317-20325[Abstract/Free Full Text].
|
| 46.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 47.
|
Schagger, H., and G. von Jagow.
1987.
Tricine-sodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100 kDa.
Anal. Biochem.
166:368-379[CrossRef][Medline].
|
| 48.
|
Schmedt, C.,
D. R. Taylor,
L. Manche,
S. R. Green,
Y. Ma, and M. B. Mathews.
1995.
Functional characterization of the RNA binding domain and motif of the double-stranded RNA-dependent protein kinase DAI.
J. Mol. Biol.
249:29-44[CrossRef][Medline].
|
| 49.
|
St. Johnston, D.,
N. H. Brown,
J. G. Gall, and M. Jantsch.
1992.
A conserved double-stranded RNA-binding domain.
Proc. Natl. Acad. Sci. USA
89:10979-10983[Abstract/Free Full Text].
|
| 50.
|
Taylor, D. R.
2000.
Hepatitis C virus: evasion of the interferon-induced antiviral response.
J. Mol. Med.
78:182-190[CrossRef][Medline].
|
| 51.
|
Taylor, D. R.,
S. B. Lee,
P. R. Romano,
D. R. Marshak,
A. G. Hinnebusch,
M. Esteban, and M. B. Mathews.
1996.
Autophosphorylation sites participate in the activation of the double-stranded-RNA-activated protein kinase PKR.
Mol. Cell. Biol.
16:6295-6302[Abstract].
|
| 52.
|
Taylor, D. R.,
S. T. Shi,
P. R. Romano,
G. N. Barber, and M. M. Lai.
1999.
Inhibition of the interferon-inducible protein kinase PKR by HCV E2 protein.
Science
285:107-110[Abstract/Free Full Text].
|
| 53.
|
Thomis, D. C.,
J. P. Doohan, and C. E. Samuel.
1992.
Mechanism of interferon action: cDNA structure, expression, and regulation of the interferon-induced, RNA-dependent P1/eIF-2 protein kinase from human cells.
Virology
188:33-46[CrossRef][Medline].
|
| 54.
|
Thomis, D. C., and C. E. Samuel.
1992.
Mechanism of interferon action: autoregulation of RNA-dependent P1/eIF-2 alpha protein kinase (PKR) expression in transfected mammalian cells.
Proc. Natl. Acad. Sci. USA
89:10837-10841[Abstract/Free Full Text].
|
| 55.
|
Thomis, D. C., and C. E. Samuel.
1995.
Mechanism of interferon action: characterization of the intermolecular autophosphorylation of PKR, the interferon-inducible, RNA-dependent protein kinase.
J. Virol.
69:5195-5198[Abstract].
|
| 56.
|
Williams, B. R. G.
1995.
The role of the dsRNA-activated kinase, PKR, in signal transduction.
Virology
6:191-202.
|
| 57.
|
Wu, S., and R. J. Kaufman.
1997.
A model for the double-stranded RNA (dsRNA)-dependent dimerization and activation of the dsRNA-activated protein kinase PKR.
J. Biol. Chem.
272:1291-1296[Abstract/Free Full Text].
|
| 58.
|
Zhang, X.,
C. J. Herring,
P. R. Romano,
J. Szczepanowska,
H. Brzeska,
A. G. Hinnebusch, and J. Qin.
1998.
Identification of phosphorylation sites in proteins separated by polyacrylamide gel electrophoresis.
Anal. Chem.
70:2050-2059[Medline].
|
| 59.
|
Zhu, S.,
P. R. Romano, and R. C. Wek.
1997.
Ribosome targeting of PKR is mediated by two double-stranded RNA-binding domains and facilitates in vivo phosphorylation of eukaryotic initiation factor-2.
J. Biol. Chem.
272:14434-14441[Abstract/Free Full Text].
|
| 60.
|
Zoller, M. J., and M. Smith.
1984.
Oligonucleotide-directed mutagenesis: a simple method using two oligonucleotide primers and a single-stranded DNA template.
DNA
3:479-488[Medline].
|
Journal of Virology, February 2001, p. 1265-1273, Vol. 75, No. 3
0022-538X/01/$04.00+0 DOI: 10.1128/JVI.75.3.1265-1273.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Wohnsland, A., Hofmann, W. P., Sarrazin, C.
(2007). Viral Determinants of Resistance to Treatment in Patients with Hepatitis C. Clin. Microbiol. Rev.
20: 23-38
[Abstract]
[Full Text]
-
Taylor, D. R., Puig, M., Darnell, M. E. R., Mihalik, K., Feinstone, S. M.
(2005). New Antiviral Pathway That Mediates Hepatitis C Virus Replicon Interferon Sensitivity through ADAR1. J. Virol.
79: 6291-6298
[Abstract]
[Full Text]
-
Bigger, C. B., Guerra, B., Brasky, K. M., Hubbard, G., Beard, M. R., Luxon, B. A., Lemon, S. M., Lanford, R. E.
(2004). Intrahepatic Gene Expression during Chronic Hepatitis C Virus Infection in Chimpanzees. J. Virol.
78: 13779-13792
[Abstract]
[Full Text]
-
Kalinina, O., Norder, H., Magnius, L. O.
(2004). Full-length open reading frame of a recombinant hepatitis C virus strain from St Petersburg: proposed mechanism for its formation. J. Gen. Virol.
85: 1853-1857
[Abstract]
[Full Text]
-
VYAS, J., ELIA, A., CLEMENS, M. J.
(2003). Inhibition of the protein kinase PKR by the internal ribosome entry site of hepatitis C virus genomic RNA. RNA
9: 858-870
[Abstract]
[Full Text]
-
Pavio, N., Romano, P. R., Graczyk, T. M., Feinstone, S. M., Taylor, D. R.
(2003). Protein Synthesis and Endoplasmic Reticulum Stress Can Be Modulated by the Hepatitis C Virus Envelope Protein E2 through the Eukaryotic Initiation Factor 2{alpha} Kinase PERK. J. Virol.
77: 3578-3585
[Abstract]
[Full Text]
-
Park, M.-S., Shaw, M. L., Munoz-Jordan, J., Cros, J. F., Nakaya, T., Bouvier, N., Palese, P., Garcia-Sastre, A., Basler, C. F.
(2002). Newcastle Disease Virus (NDV)-Based Assay Demonstrates Interferon-Antagonist Activity for the NDV V Protein and the Nipah Virus V, W, and C Proteins. J. Virol.
77: 1501-1511
[Abstract]
[Full Text]
-
Pang, Q., Christianson, T. A., Keeble, W., Koretsky, T., Bagby, G. C.
(2002). The Anti-apoptotic Function of Hsp70 in the Interferon-inducible Double-stranded RNA-dependent Protein Kinase-mediated Death Signaling Pathway Requires the Fanconi Anemia Protein, FANCC. J. Biol. Chem.
277: 49638-49643
[Abstract]
[Full Text]
-
Rivas-Estilla, A. M., Svitkin, Y., Lopez Lastra, M., Hatzoglou, M., Sherker, A., Koromilas, A. E.
(2002). PKR-Dependent Mechanisms of Gene Expression from a Subgenomic Hepatitis C Virus Clone. J. Virol.
76: 10637-10653
[Abstract]
[Full Text]
-
Tan, S.-L., Tareen, S. U., Melville, M. W., Blakely, C. M., Katze, M. G.
(2002). The Direct Binding of the Catalytic Subunit of Protein Phosphatase 1 to the PKR Protein Kinase Is Necessary but Not Sufficient for Inactivation and Disruption of Enzyme Dimer Formation. J. Biol. Chem.
277: 36109-36117
[Abstract]
[Full Text]
-
Pavio, N., Taylor, D. R., Lai, M. M. C.
(2002). Detection of a Novel Unglycosylated Form of Hepatitis C Virus E2 Envelope Protein That Is Located in the Cytosol and Interacts with PKR. J. Virol.
76: 1265-1272
[Abstract]
[Full Text]
-
V. Jammi, N., Beal, P. A.
(2001). Phosphorylation of the RNA-dependent protein kinase regulates its RNA-binding activity. Nucleic Acids Res
29: 3020-3029
[Abstract]
[Full Text]