This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.

 Previous Article  |  Next Article 

Journal of Virology, February 2001, p. 1165-1171, Vol. 75, No. 3
0022-538X/01/$04.00+0   DOI: 10.1128/JVI.75.3.1165-1171.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.

Improved Elicitation of Neutralizing Antibodies against Primary Human Immunodeficiency Viruses by Soluble Stabilized Envelope Glycoprotein Trimers

Xinzhen Yang,1,2 Richard Wyatt,1,3 and Joseph Sodroski1,2,4,*

Department of Cancer Immunology & AIDS, Dana-Farber Cancer Institute,1 Department of Pathology2 and Department of Medicine,3 Harvard Medical School, and Department of Immunology and Infectious Diseases, Harvard School of Public Health,4 Boston, Massachusetts 02115

Received 31 July 2000/Accepted 17 October 2000


    ABSTRACT
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Human immunodeficiency virus (HIV-1) envelope glycoprotein subunits, such as the gp120 exterior glycoprotein, typically elicit antibodies that neutralize T-cell-line-adapted (TCLA), but not primary, clinical isolates of HIV-1. Here we compare the immunogenicity of gp120 and soluble stabilized trimers, which were designed to resemble the functional envelope glycoprotein oligomers of primary and TCLA HIV-1 strains. For both primary and TCLA virus proteins, soluble stabilized trimers generated neutralizing antibody responses more efficiently than gp120 did. Trimers derived from a primary isolate elicited antibodies that neutralized primary and TCLA HIV-1 strains. By contrast, trimers derived from a TCLA isolate generated antibodies that neutralized only the homologous TCLA virus. Thus, soluble stabilized envelope glycoprotein trimers derived from primary HIV-1 isolates represent defined immunogens capable of eliciting neutralizing antibodies that are active against clinically relevant HIV-1 strains.


    INTRODUCTION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

The human immunodeficiency virus (HIV-1) glycoproteins are initially synthesized as a polyprotein precursor that undergoes posttranslational modifications including glycosylation, oligomerization, and proteolytic cleavage between the gp120 and gp41 subunits (2, 22, 23, 56, 77, 82). The mature envelope glycoproteins are transported to the cell surface, where they are incorporated into the virus as an oligomeric complex. The preponderance of evidence indicates that the mature oligomer consists of and functions as a trimer of gp120-gp41 heterodimers (11, 24, 39, 55, 69, 78). The envelope glycoprotein complex promotes viral entry into host cells by binding cellular receptors and mediating the fusion of the viral and cellular membranes (1, 13, 16, 17, 19, 20, 25, 34, 43). The gp120 exterior envelope glycoprotein binds the CD4 molecule, which facilitates the interaction of gp120 with a second receptor (typically, the chemokine receptors CCR5 or CXCR4) (74, 81). The interactions between gp120 and the cellular receptor molecules are believed to trigger conformational changes in the envelope glycoprotein complex important for the membrane fusion process (12, 64, 68).

Most antibodies elicited against the HIV-1 envelope glycoproteins during natural infection or after vaccination are incapable of neutralizing HIV-1 infectivity in vitro (3, 4, 14, 29, 33, 41, 42, 54, 57, 75, 76, 79). Neutralizing antibodies that are elicited often are restricted to a limited number of HIV-1 strains. These antibodies recognize variable structures on the surface of the gp120 exterior glycoprotein, in particular the gp120 variable loops (18, 45, 47, 49, 52, 54, 58, 60). Only after several months of natural HIV-1 infection are more broadly neutralizing antibodies directed against the conserved receptor-binding regions of gp120 elicited (5, 10, 31, 32, 35, 53, 54, 61, 65, 70-73, 82, 83). These antibodies have been difficult to elicit with subunit vaccine candidates (3, 4, 14, 28, 29, 41, 42, 57, 75, 76).

A further problem confronting the elicitation of protective antibody responses against HIV-1 infection is the relative resistance to antibody-mediated neutralization of primary, clinical HIV-1 isolates compared with T-cell-line-adapted (TCLA) HIV-1 strains (8, 15, 27, 40-42, 46, 48, 50, 51, 59, 79, 80, 86). Considerably higher concentrations of most neutralizing antibodies are required to inhibit the infection of primary HIV-1 strains, some of which are even enhanced by subneutralizing concentrations of antibodies (62, 63, 66, 67).

To date, most recombinant HIV-1 glycoproteins tested as vaccine candidates have been gp120 monomers. The antibody responses to gp120 are not usually effective in neutralizing primary HIV-1 isolates (3, 4, 6, 14, 28, 29, 41, 57, 76, 79). To attempt to mimic the native HIV-1 envelope glycoprotein oligomer, soluble gp140 glycoproteins containing gp120 and the gp41 ectodomain have been created (9, 22). When the gp120-gp41 junction is modified to reduce proteolytic cleavage, these soluble gp140 glycoproteins assemble into dimers and tetramers in addition to the monomeric forms (9, 21, 22). The elicitation of neutralizing antibodies by oligomeric forms of soluble gp140 has been disappointing, perhaps because these oligomers do not fully resemble the biologically relevant envelope glycoprotein trimers (6, 21, 33, 75).

Attempts to produce HIV-1 envelope glycoprotein trimers for structural and immunologic analysis have been frustrated by the lability of these glycoprotein complexes. Both the intersubunit interactions that promote trimer formation and the association between gp120 and gp41 are labie (26, 44). Modifications of the gp120-gp41 cleavage site and introduction of cysteine cross-links between gp120 and gp41 have been employed to address the latter problem (7, 9, 22). The addition of trimeric motifs from the GCN4 transcription factor (30) to the carboxyl terminus of soluble HIV-1 envelope glycoproteins has been successfully used to overcome the instability of the oligomeric associations and the tendency of the envelope glycoprotein ectodomains to form dimers and tetramers (84, 85). Here we test the hypothesis that these soluble stabilized HIV-1 envelope glycoprotein trimers will elicit virus-neutralizing antibodies more effectively than monomeric gp120 will.


    MATERIALS AND METHODS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Plasmids. Details of the plasmids expressing soluble, stabilized trimers have been previously reported (84, 85). Briefly, all plasmids were derivatives of the pSVIIIenv vector (66). For production of soluble gp120 monomers, a stop codon was introduced into the env gene of the pSVIIIenv plasmid, resulting in termination after arginine 508 (amino acid residues are numbered as in the HXBc2 prototype). The gp120-gp41 proteolytic cleavage site was modified in the soluble, stabilized trimers by altering the arginines at residues 508 and 511 to serines. The GCN4 trimeric motif (MKQIEDKIEEILSKIYHIENEIARIKKLIGEV) (30) was positioned after leucine 593 in the gp130(-/GCN4) construct, after lysine 675 in the gp140Delta 675(-/GCN4) construct, and after lysine 683 and a pair of glycine residues in the gp140Delta 683(-/GCN4) construct. The open reading frames of these constructs were sequenced in their entirety to confirm that only the desired changes had been introduced.

Protein expression and purification. Envelope glycoproteins were produced by transfection of 40 100-mm plates of 293T cells with the pSVIIIenv plasmid and another plasmid expressing the HIV-1 Tat protein, using Effectene reagents (Qiagen). The envelope glycoproteins were purified from the pooled supernatants using an F105 antibody affinity column as described previously (36, 81). The protein preparations were evaluated for purity and quantified by comparison with serial dilutions of bovine serum albumin (BSA) after resolution on sodium dodecyl sulfate-7.5% polyacrylamide gels. The purified envelope glycoproteins were stored in aliquots at -20°C.

Immunization and serum preparation. The amounts of each envelope glycoprotein in the inoculum were adjusted so that each animal received the same molar quantity of the gp120 moiety, which is the major target for neutralizing antibodies (5, 29, 42, 54, 65, 75, 76, 82, 83). Thus, the following amounts of each protein were added to 200 µl (final volume) of a solution containing 1× Ribi adjuvant (Sigma): 6.8 µg of YU2 gp120, 7.8 µg of YU2 gp130(-/GCN4), 9.0 µg of YU2 gp140Delta 675(-/GCN4) or gp140Delta 683(-/GCN4), 6.5 µg of HXBc2 gp120, and 9.0 µg of HXBc2 gp140Delta 675(-/GCN4). As controls, 9.0 µg of bovine serum albumin (BSA) or phosphate-buffered saline (PBS) alone was inoculated. Groups of at least six BALB/c female mice (Taconic) were inoculated subcutaneously with 200 µl of the immunogen solutions at three separate sites. Inoculations were administered at the ages of 9, 13, and 17 weeks. Eye bleeding was performed at 7 and 14 days after the third injection. Following clot formation for 24 h at 4°C, the samples were centrifuged at 13,000 × g for 10 min at room temperature and the sera were harvested in a sterile manner. The two serum samples from each mouse were pooled and incubated at 55°C for 1 h to inactivate complement. The sera were then stored at 4°C.

HIV-1 neutralization assay. The HIV-1-neutralizing activity of the serum samples was tested using a single-round virus entry assay. Recombinant HIV-1 expressing the firefly luciferase gene was produced by transfecting 293T cells with the pCMV Gag-Pol packaging construct and the pHIV-luc vector, along with a pSVIIIenv plasmid expressing the envelope glycoproteins of different HIV-1 strains (66; M. Koch, P. D. Kwong, P. Kolchinsky, L. Wang, W. Hendrickson, J. Sodroski, and R. Wyatt, submitted for publication). Two days after transfection, the cell supernatants were harvested and frozen in aliquots as viral stocks.

To create target cells, 2.5 × 106 Cf2Th canine thymocytes were transfected using Lipofectamine PLUS (Gibco Lifetech, Inc.) with 5 µg each of plasmids expressing human CD4 and either human CCR5 or CXCR4, as appropriate for the infecting virus (13). After being cultured overnight, the transfected cells were detached from the plates using 10 mM EDTA-PBS. After being washed in PBS, 6 × 103 cells were distributed into each well of a 96-well cell culture plate (Dynex). After overnight incubation, the cells were used for infection.

To quantify the infectivity of each viral stock, different amounts of the stocks were diluted to 200 µl using growth medium and incubated at 37°C for 1 h. Growth medium was thoroughly removed from the target cells, and 50 µl of the virus suspension was added to triplicate wells. The virus-cell mixture was incubated at 37°C in 5% CO2 for 2 h, after which the medium was aspirated and the cells were washed once with 200 µl of prewarmed growth medium per well. After aspiration of the medium, another 200 µl of growth medium was added, and the cells were cultured for 2 days. At this time, luciferase activity was measured using the luciferase assay system (Pharmingen). Any values more than 200% above or less than 50% below the median value of triplicates were excluded from calculation of the mean infectivity titer. In practice, less than 10% variation was observed for the infectivity of viral stocks within an experiment. The linear range of the assay extended from 50 to 2 × 105 arbitrary luciferase units (data not shown).

In the neutralization assays, an amount of viral stock sufficient to result in luciferase activity of approximately 105 units was diluted to 50 µl in Dulbecco modified Eagle medium-10% fetal bovine serum. The mouse sera were diluted in the same medium, and the final volume was adjusted to 150 µl. The virus and sera were then mixed, briefly vortexed, and incubated in a 5% CO2 incubator at 37°C for 1 h. The residual viral infectivity was then measured in the single-round infection assay as described above. The reported serum titers represent the dilution of the serum in the final virus-serum mixture that resulted in either 50 or 90% neutralization, compared with the infectivity of viruses incubated with medium alone.

Measurement of anti-gp120 reactivity of sera. To quantitate anti-gp120 reactivity in the sera, 15 ng of the YU2 or HXBc2 gp120 glycoprotein produced in Drosophila cells (36, 81) was adsorbed onto the well of an enzyme-linked immunosorbent assay (ELISA) plate (Costar) overnight at 4°C. After blocking the plates, 100 µl of serially diluted serum from mice immunized with envelope glycoproteins were applied to each well for 1 h. After consecutive incubation with biotinylated anti-mouse immunoglobulin G (IgG) (Sigma) and streptavidin-horseradish peroxidase (Pierce), the plates were vigorously washed and developed with the TMB peroxidase substrate kit (Bio-Rad). A well was classified as positive if the value was greater than 200% of the average values observed in the four wells that were incubated with the dilution buffer only. These negative controls exhibited a standard deviation of no more than 20% of the mean value.


    RESULTS
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

Soluble stabilized envelope glycoprotein trimers. To create soluble forms of the HIV-1 envelope glycoproteins, the proteins were truncated at various locations within the gp41 ectodomain. In addition, the natural cleavage site between the gp120 and gp41 glycoproteins was altered to minimize proteolytic processing at this site (Fig. 1). Although these two modifications result in soluble envelope glycoproteins, such proteins exhibit considerable heterogeneity, forming monomers, dimers, tetramers, and other oligomers (21, 22). To promote the formation of soluble trimers, a sequence from the GCN4 transcription factor that was modified to form trimeric coiled coils (30) was appended to the carboxyl terminus of the soluble envelope glycoproteins (84, 85). Three constructs that differ in the location of the carboxyl terminus, gp 130(-/GCN4), gp140Delta 675(-/GCN4), and gp140Delta 683(-/GCN4), were studied. All three soluble glycoproteins assemble into relatively homogeneous, stable trimers (84, 85). The antibody-accessible surface of the last two trimers closely resembles that expected for the virion envelope glycoprotein complex, although subtle differences between these two molecules were observed (85).


View larger version (18K):
[in this window]
[in a new window]
 
FIG. 1.   HIV-1 envelope glycoprotein immunogens used in this study. The linear map of the HIV-1 gp120 and gp41 envelope glycoproteins is shown in the top diagram. The gp120 variable regions (V1 to V5) and the gp41 alpha -helical regions (N36 and C34) and transmembrane region (TM) are indicated. The soluble gp120 envelope glycoprotein was produced by a plasmid in which a stop codon was introduced into the HIV-1 env gene (from either the YU2 or HXBc2 strain) such that the encoded protein was truncated immediately after arginine 508. In the gp130 and gp140 constructs, the gp120-gp41 cleavage site was altered by the introduction of serine substitutions for arginines at positions 508 and 511 (indicated by SS) (84, 85). The GCN4 trimeric motif (30) was added to the carboxyl terminus of some of the constructs (indicated by GCN4). The GCN4 motif was added immediately after the indicated gp41 amino acid residue, except in the gp140Delta 683(-/GCN4) construct, where two glycines separate the gp41 terminus and the GCN4 sequences.

Soluble, stabilized trimers derived from two different clade B HIV-1 strains were expressed in a human cell line and purified to greater than 95% homogeneity. The two strains were chosen to represent the extremes of phenotypic variation exhibited by HIV-1 isolates. The YU2 primary strain of HIV-1 was not passaged in tissue culture prior to molecular cloning (38). This CCR5-using virus is one of the most difficult HIV-1 isolates to neutralize with antibodies or soluble forms of the CD4 receptor, and it often demonstrates significant enhancement by these ligands (66, 67). The TCLA HXBc2 strain of HIV-1, by contrast, utilizes CXCR4 as a coreceptor and is extremely sensitive to antibody-mediated neutralization (66).

Mouse immunization and neutralization assay. The immunogenicities of the soluble, stabilized trimers and gp120 monomers were compared in mice. Previous studies have demonstrated that gp120 induces neutralizing antibodies active against clinical HIV-1 isolates only after multiple immunizations, and then only at very low titers and with limited breadth (3, 4, 6, 14, 28, 29, 41, 57, 76, 79). Nonetheless, since no other defined immunogen has proven consistently superior to gp120 in this respect, the use of gp120 as a point of comparison was reasonable (6, 33, 41, 75). In this study, we utilized a conservative immunization protocol consisting of a priming inoculation followed by two boosts. Sera were collected from each immunized mouse at 1 and 2 weeks following the last boost, pooled, and assessed for virus-neutralizing activity. For this purpose, recombinant HIV-1 strains containing different envelope glycoproteins and expressing firefly luciferase were incubated with the sera and then used to infect canine thymocytes expressing CD4 and the appropriate chemokine receptor. The efficiency of this single round of infection was assessed by measurement of luciferase activity in the target cells 2 days after infection. This neutralization assay is quantitative, reproducible and relatively resistant to nonspecific effects of animal sera on the target cells. Three clade B HIV-1 envelope glycoproteins, YU2, ADA, and HXBc2, were incorporated into the recombinant viruses used in the assay. The ADA primary isolate, like YU2, is resistant to neutralizing antibodies, whereas HXBc2 is quite sensitive to neutralizing antibodies (66). This is reflected in the amounts of a highly potent neutralizing antibody, lgG1b12, required to inhibit recombinant viruses containing the three envelope glycoproteins (10). Whereas 90% neutralization of the HXBc2 virus was observed in the presence of only 1.25 µg of lgG1b12 per ml, the same degree of neutralization of the ADA and YU2 viruses could not be achieved by 10 and 20 µg of lgG1b12 per ml, respectively. Approximately 50% neutralization of the ADA and YU2 viruses was observed at 2.5 and 5 µg of lgG1b12 per ml, respectively (data not shown).

Neutralizing antibodies elicited by primary HIV-1 envelope glycoproteins. Sera collected at 1 and 2 weeks following the second boost were pooled and examined for gp120 reactivity and neutralizing activity. The immune responses to the YU2 envelope glycoprotein variants are summarized in Table 1. All of the YU2 envelope glycoproteins elicited roughly comparable titers of antibodies reactive with the homologous YU2 gp120 glycoprotein captured on an ELISA plate. The titers of antibodies recognizing the HXBc2 gp120 glycoprotein were not higher in the sera of mice immunized with the trimeric YU2 glycoproteins than in the sera of gp 120-immunized animals (data not shown). None of the sera from mice immunized with the YU2 gp120 glycoprotein exhibited neutralizing activity against any of the viruses. By contrast, the soluble, stabilized YU2 trimers elicited neutralizing antibodies. The YU2 gp130 (-/GCN4) and gp140Delta 675(-/GCN4) glycoproteins generated serum responses that in some cases neutralized the heterologous viruses but did not neutralize the homologous YU2 virus. This pattern of neutralization probably reflects the relative ease of neutralization of the three viruses (66). The sera of several mice immunized with the YU2 gp140Delta 683(-/GCN4) glycoprotein neutralized all three HIV-1 strains. Four of six sera from this group of immunized mice mediated 90% neutralization of the YU2 virus at dilutions of 1:20 or greater; even 20 µg of the lgG1b12 antibody per ml could not achieve this level of neutralization in this assay. These results indicate that the soluble, stabilized YU2 trimers, particularly the gp140Delta 683(-/GCN4) glycoprotein, can elicit antibodies that neutralize primary HIV-1 isolates. In this respect, soluble, stabilized YU2 trimers appear to be significantly more effective than the monomeric YU2 gp120 glycoprotein.

                              
View this table:
[in this window]
[in a new window]
 
TABLE 1.   Immune responses following immunization with primary HIV-1 envelope glycoproteins

To evaluate the breadth of neutralizing antibody responses elicited by the soluble, stabilized YU2 trimers, the sera were tested against recombinant viruses containing the envelope glycoproteins of primary HIV-1 isolates from clade B as well as clades C, D, and E. Due to limitations in the amount of sera available, these experiments were performed at only one dilution (1:20). Again, the three soluble, stabilized YU2 trimers induced better neutralizing antibodies against the 89.6 and JR-FL viruses, two clade B HIV-1 strains, than the gp120 glycoprotein did (data not shown). This neutralizing activity was weaker than that seen for viruses with the YU2 and ADA envelope glycoproteins. The gp140Delta 683(-/GCN4) glycoprotein was not significantly different from the other two trimeric forms in the elicitation of neutralizing antibodies against the 89.6 and JR-FL strains. No neutralizing activity was observed against recombinant viruses containing the envelope glycoproteins from primary isolates outside of clade B (data not shown).

Antibodies elicited by TCLA HIV-1 envelope glycoproteins. To examine whether the strain of the envelope glycoprotein immunogen can influence the results, mice were immunized with the gp120 and gp140Delta 683(-/GCN4) glycoproteins derived from the HXBc2 TCLA HIV-1 strain. The HXBc2 trimers elicited more consistent neutralizing antibody responses than the HXBc2 gp120 glycoprotein did (Table 2). However, this neutralizing activity was almost exclusively restricted to the homologous HXBc2 virus and did not inhibit infection by the primary viruses, ADA and YU2. These results suggest that the strain from which the envelope glycoprotein components of soluble, stabilized trimers are derived can influence the efficiency with which neutralizing activity against clinical HIV-1 isolates is generated.

                              
View this table:
[in this window]
[in a new window]
 
TABLE 2.   Immune responses following immunization with TCLA HIV-1 envelope glycoproteins


    DISCUSSION
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

The development of an HIV-1 vaccine has been frustrated in part by the difficulty of eliciting neutralizing antibodies active against clinical HIV-1 isolates (3, 4, 6, 14, 28, 29, 41, 42, 57, 76, 79). To date, no defined immunogen has proven better than the gp120 glycoprotein, which generates primary virus-neutralizing activity only after an aggressive immunization protocol involving many boosts (3, 4, 14, 28, 29, 41, 42, 57, 76). Immunization of specific transgenic mice with mixtures of cells expressing envelope glycoproteins and receptors has been reported to yield antibodies able to neutralize a broad range of primary HIV-1 isolates (37); however, despite extensive efforts, the relevant immunogen has not been defined and the reproducibility and general applicability of the results have not been demonstrated. Our results indicate that soluble, stabilized trimers are more effective than gp120 at eliciting antibodies that neutralize HIV-1. Such trimers may represent more faithful mimics of the functional envelope glycoprotein complex, may retain relevant conformations more stably in vivo, and may present multiple, cross-linked epitopes to responding B lymphocytes.

Our results suggest that the HIV-1 strain from which the soluble, stabilized trimers are derived can influence the elicitation of primary virus-neutralizing activity. The trimers derived from the primary YU2 isolate generated better neutralizing responses against clinical HIV-1 isolates than did trimers from a TCLA virus. This suggests that some primary virus trimers can elicit antibodies that recognize structures common to several primary isolates and at least one TCLA HIV-1 isolate. The neutralizing antibodies generated by the TCLA virus trimer, although quite potent against the homologous TCLA isolate, were not generally active against the primary isolates tested. Despite the similarity of recognition of the YU2 and HXBc2 trimers by antibodies directed against conserved epitopes (85), the neutralizing antibody response to the TCLA virus trimer appears to be dominated by reactivity with more strain-specific elements. The properties that render soluble, stabilized trimers from certain HIV-1 strains more effective as immunogens merit further investigation.

The YU2 gp140Delta 683(-/GCN4) trimers, which contain the complete HIV-1 envelope glycoprotein ectodomains, raised antibodies that inhibited the YU2 virus, one of the primary HIV-1 isolates most resistant to antibody-mediated neutralization. The neutralizing activity of this sera, at 1:20 and 1:40 dilutions, was comparable in our assay to that of 5 to 20 µg of the lgG1b12 antibody per ml, one of the most potent HIV-1-neutralizing antibodies identified to date (10). Thus, with the appropriate immunogen, neutralizing active against even relatively refractory primary HIV-1 isolates is achievable using a conservative immunization protocol.

Although soluble, stabilized trimers appeared to elicit some qualitatively desirable neutralizing antibody responses, efforts to improve the titer and breadth of these responses are clearly merited. The titers of primary-virus-neutralizing antibodies observed in our immunized mice were low. Furthermore, the breadth of neutralization was limited to a subset of clade B viruses. These limitations may reflect intrinsic immunogenic properties of the HIV-1 envelope glycoprotein complexes. Alternatively, the soluble stabilized trimers may imperfectly mimic the functional virion envelope glycoprotein spikes. Further modifications of the immunogens and methods of antigen presentation to the immune system may lead to improved neutralizing antibody responses.


    ACKNOWLEDGMENTS

We thank E. Myers for assistance with animal handling. We also thank Y. McLaughlin and S. Farnum for manuscript preparation.

This work was supported by NIH grants AI24755, AI31783, and AI39420 to J.S. and NIH CFAR grant AI28691. We also acknowledge the support of the G. Harold and Leila Mathers Foundation, the Friends 10, Douglas and Judith Krupp, and the late William F. McCarty-Cooper.


    FOOTNOTES

* Corresponding author. Mailing address: Department of Cancer Immunology & AIDS, Dana-Farber Cancer Institute, 44 Binney St., JFB 824, Boston, MA 02115. Phone: (617) 632-3371. Fax: (617) 632-4338. E-mail: Joseph_Sodroski{at}dfci.harvard.edu.


    REFERENCES
Top
Abstract
Introduction
Materials and Methods
Results
Discussion
References

1. Alkhatib, G., C. Combadiere, C. C. Broder, Y. Feng, P. E. Kennedy, P. M. Murphy, and E. A. Berger. 1996. CC CKR5: a RANTES, MIP-1alpha, MIP-1beta receptor as a fusion cofactor for macrophage-tropic HIV-1. Science 272:1955-1958[Abstract].
2. Allan, J. S., J. E. Coligan, F. Barin, J. Sodroski, C. A. Rosen, W. A. Haseltine, T.-H. Lee, and M. Essex. 1985. Major glycoprotein antigens that induce antibodies in AIDS patients are encoded by HTLV-III. Science 228:1091-1094[Abstract/Free Full Text].
3. Barnett, S. W., S. Rajasekar, H. Legg, B. Doe, D. H. Fuller, J. R. Haynes, C. M. Walker, and K. S. Steimer. 1997. Vaccination with HIV-1 gp120 DNA induces immune responses that are boosted by a recombinant gp120 protein subunit. Vaccine 15:869-873[CrossRef][Medline].
4. Belshe, R. B., G. J. Gorse, M. J. Mulligan, T. G. Evans, M. C. Keefer, J.-L. Excler, A. M. Duliege, J. Tartaglia, W. I. Cox, J. McNamara, K.-L. Hwang, A. Bradney, D. C. Montefiori, and K. J. Weinhold. 1998. Induction of immune responses to HIV-1 by canarypox virus (ALVAC) HIV-1 and gp120 SF-2 recombinant vaccines in uninfected volunteers. AIDS 12:2407-2415[CrossRef][Medline].
5. Berkower, I., G. Smith, C. Giri, and D. Murphy. 1989. Human immunodeficiency virus 1. Predominance of a group-specific neutralizing epitope that persists despite genetic variation. J. Exp. Med. 170:1681-1695[Abstract/Free Full Text].
6. Berman, P. W., T. J. Gregory, L. Riddle, G. R. Nakamura, M. A. Champe, J. P. Porter, F. M. Wurm, R. D. Hershberg, E. K. Cobb, and J. W. Eichberg. 1990. Protection of chimpanzees from infections by HIV-1 after vaccination with recombinant glycoprotein gp120 but not gp160. Nature 345:622-625[CrossRef][Medline].
7. Binley, J. M., R. W. Sanders, B. Clas, N. Schuelke, A. Master, Y. Guo, F. Kajumo, D. J. Anselma, P. J. Maddon, W. C. Olson, and J. P. Moore. 2000. A recombinant immunodeficiency virus type 1 envelope glycoprotein complex stabilized by an intermolecular disulfide bond between the gp 120 and gp41 subunits is an antigenic mimic of the trimeric virion-associated structure. J. Virol. 74:627-643[Abstract/Free Full Text].
8. Bou-Habib, D. C., G. Roderiquez, T. Oravecz, P. W. Berman, P. Luzzo, and M. Norcross. 1994. Cryptic nature of envelope V3 region epitopes protects primary monocytotropic human immunodeficiency virus type 1 from antibody neutralization. J. Virol. 68:6006-6013[Abstract/Free Full Text].
9. Broder, C. C., P. L. Earl, D. Long, S. T. Abedon, B. Moss, and R. W. Doms. 1994. Antigenic implications of human immunodeficiency virus type 1 envelope quatemary structure: oligomer-specific and -sensitive monoclonal antibodies. Proc. Natl. Acad. Sci. USA 91:11699-11703[Abstract/Free Full Text].
10. Burton, D. R., J. Pyati, R. Koduri, G. B. Thornton, L. S. W. Sawyer, R. M. Hendry, N. Dunlop, P. L. Nara, M. Lamacchia, E. Garratty, E. R. Stiehm, Y. J. Bryson, J. P. Moore, D. D. Ho, and C. F. Barbas, III. 1994. Efficient neutralization of primary isolates of HIV-1 by a recombinant monoclonal antibody. Science 266:1024-1027[Abstract/Free Full Text].
11. Chan, D. C., D. Fass, J. M. Berger, and P. S. Kim. 1997. Core structure of gp41 from the HIV envelope glycoprotein. Cell 89:263-273[CrossRef][Medline].
12. Chan, D. C., and P. S. Kim. 1998. HIV entry and its inhibition. Cell 93:681-684[CrossRef][Medline].
13. Choe, H., M. Farzan, Y. Sun, N. Sullivan, B. Rollins, P. D. Ponath, L. Wu, C. R. Mackay, G. LaRosa, W. Newman, N. Gerard, C. Gerard, and J. Sodroski. 1996. The beta -chemokine receptors CCR3 and CCR5 facilitate infection by primary HIV-1 isolates. Cell 85:1135-1148[CrossRef][Medline].
14. Connor, R. I., B. T. Korber, B. S. Graham, B. H. Hahn, D. D. Ho, R. D. Walker, A. U. Neumann, S. H. Vermund, J. Mestecky, S. Jackson, E. Fenamore, Y. Cao, F. Gao, S. Kalam, K. J. Kunstman, D. McDonald, N. McWilliams, A. Trkola, J. P. Moore, and S. M. Wolinsky. 1998. Immunological and virological analyses of persons infected by human immunodeficiency virus type 1 while participating in trials of recombinant subunit vaccines. J. Virol. 72:1552-1576[Abstract/Free Full Text].
15. Daar, E. S., X. L. Li, T. Moudgil, and D. D. Ho. 1990. High concentrations of recombinant soluble CD4 are required to neutralize primary human immunodeficiency virus type 1 isolates. Proc. Natl. Acad. Sci. USA 87:6574-6578[Abstract/Free Full Text].
16. Dalgleish, A. G., P. C. Beverley, P. R. Clapham, D. H. Crawford, M. F. Greaves, and R. A. Weiss. 1984. The CD4 (T4) antigen is an essential component of the receptor for the AIDS retrovirus. Nature 312:763-767[CrossRef][Medline].
17. Deng, H., R. Liu, W. Ellmeier, S. Choe, D. Unutmaz, M. Burkhart, P. Di Marzio, S. Marmon, R. E. Sutton, C. M. Hill, C. B. Davis, S. C. Peiper, T. J. Schall, D. R. Littman, and N. R. Landau. 1996. Identification of a major co-receptor for primary isolates of HIV-1. Nature 381:661-666[CrossRef][Medline].
18. Ditzel, H. J., J. M. Binley, J. P. Moore, J. Sodroski, N. Sullivan, L. Sawyer, R. M. Hendry, W. Yang, C. F. Barbas III, and D. R. Burton. 1995. Neutralizing recombinant human antibodies to a conformational V2- and CD4-binding site-sensitive epitope of HIV-1 gp120 isolated by using an epitope-masking procedure. J. Immunol. 154:893-906[Abstract].
19. Doranz, B. J., J. Rucker, Y. Yi, R. J. Smyth, M. Samson, S. C. Peiper, M. Parmentier, R. G. Collman, and R. W. Doms. 1996. A dual-tropic primary HIV-1 isolate that uses fusin and the beta-chemokine receptors CKR-5, CKR-3, and CKR-2b as fusion cofactors. Cell 85:1149-1158[CrossRef][Medline].
20. Dragic, T., V. Litwin, G. P. Allaway, S. R. Martin, Y. Huang, K. A. Nagashima, C. Cayanan, P. J. Maddon, R. A. Koup, J. P. Moore, and W. A. Paxton. 1996. HIV-1 entry into CD4+ cells is mediated by the chemokine receptor CC- CKR-5. Nature 381:667-673[CrossRef][Medline].
21. Earl, P. L., C. C. Broder, D. Long, S. A. Lee, J. Peterson, S. Chakrabarti, R. W. Doms, and B. Moss. 1994. Native oligomeric human immunodeficiency virus type 1 envelope glycoprotein elicits diverse monoclonal antibody reactivities. J. Virol. 68:3015-3026[Abstract/Free Full Text].
22. Earl, P. L., R. W. Doms, and B. Moss. 1990. Oligomeric structure of the human immunodeficiency virus type 1 envelope glycoprotein. Proc. Natl. Acad. Sci. USA 87:648-652[Abstract/Free Full Text].
23. Earl, P. L., B. Moss, and R. W. Doms. 1991. Folding, interaction with GRP78-BiP, assembly, and transport of the human immunodeficiency virus type 1 envelope protein. J. Virol. 65:2047-2055[Abstract/Free Full Text].
24. Farzan, M., H. Choe, E. Desjardins, Y. Sun, J. Kuhn, J. Cao, D. Archambault, P. Kolchinsky, M. Koch, R. Wyatt, and J. Sodroski. 1998. Stabilization of human immunodeficiency virus type 1 envelope glycoprotein trimers by disulfide bonds introduced into the gp41 glycoprotein ectodomain. J. Virol. 72:7620-7625[Abstract/Free Full Text].
25. Feng, Y., C. C. Broder, P. E. Kennedy, and E. A. Berger. 1996. HIV-1 entry cofactor: functional cDNA cloning of a seven- transmembrane, G protein-coupled receptor. Science 272:872-877[Abstract].
26. Gelderblom, H. R., H. Reupke, and G. Pauli. 1985. Loss of envelope antigens of HTLV-III/LAV, a factor in AIDS pathogenesis? Lancet ii:1016-1017.
27. Gorny, M. K., J. P. Moore, A. J. Conley, S. Karwowska, J. Sodroski, C. Williams, S. Burda, L. J. Boots, and S. Zolla-Pazner. 1994. Human anti-V2 monoclonal antibody that neutralizes primary but not laboratory isolates of human immunodeficiency virus type 1. J. Virol. 68:8312-8320[Abstract/Free Full Text].
28. Graham, B. S., M. J. McElrah, R. I. Conner, D. H. Schwartz, G. J. Gorse, M. C. Keefer, M. J. Mulligan, T. J. Mathews, S. W. Wolinsky, D. C. Montefiori, S. H. Vermund, J. S. Lambert, L. Corey, R. B. Belshe, R. Dolin, P. F. Wrightt, B. T. Korber, M. C. Wolff, and P. E. Fast. 1998. Analysis of intercurrent human immunodeficiency virus type 1 infections in phase I and II trials of current AIDS vaccines. J. Infect. Dis. 177:310-319[Medline].
29. Haigwood, N. L., P. Nara, E. Brooks, G. Van Nest, G. Ott, K. Higgins, N. Dunlop, C. Scandella, J. Eichberg, and K. Steimer. 1992. Native but not denatured recombinant human immunodeficiency type 1 gp120 generates broad-spectrum neutralizing antibodies in baboons. J. Virol. 66:172-182[Abstract/Free Full Text].
30. Harbury, P. B., T. Zhang, P. S. Kim, and T. Alber. 1993. A switch between two-three-, and four-stranded coiled coils in GCN4 leucine zipper mutants. Science 262:1401-1407[Abstract/Free Full Text].
31. Ho, D. D., J. McKeating, X. L. Li, T. Moudgil, E. Daar, N. C. Sun, and J. Robinson. 1991. Conformational epitope on gp120 important in CD4 binding and human immunodeficiency virus type 1 neutralization identified by a human monoclonal antibody. J. Virol. 65:489-493[Abstract/Free Full Text].
32. Karwowska, S., M. Gorny, A. Buchbinder, V. Gianakakos, C. Williams, T. Fuerst, and S. Zolla-Pazner. 1992. Production of human monoclonal antibodies specific for conformational and linear non-V3 epitopes of gp120. AIDS Res. Hum. Retroviruses 8:1099-1106[Medline].
33. Klaniecki, J., T. Dykers, B. Travis, R. Schmitt, M. Wain, A. Watson, P. Sridhar, J. McClure, B. Morein, and J. T. Ulrich. 1991. Cross-neutralizing antibodies in rabbits immunized with HIV-1 gp160 purified from simian cells infected with a recombinant vaccinia virus. AIDS Res. Hum. Retroviruses 7:791-798[Medline].
34. Klatzmann, D., E. Chamoagne, S. Chamaret, J. Gruest, D. Guetard, T. Hercend, J. C. Gluckman, and L. Montagnier. 1984. T-lymphocyte T4 molecule behaves as the receptor for human retrovirus LAV. Nature 312:767-768[CrossRef][Medline].
35. Kwong, P. D., R. Wyatt, J. Robinson, R. W. Sweet, J. Sodroski, and W. A. Henderickson. 1998. Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody. Nature 393:648-659[CrossRef][Medline].
36. Kwong, P. D., R. Wyatt, E. Desjardins, J. Robinson, J. Culp, B. D. Hellmig, R. W. Sweet, J. Sodroski, and W. Hendrickson. 1999. Probability analysis of variational crystallization and its application to gp120, the exterior envelope glycoprotein of type 1 human immunodeficiency virus (HIV-1). J. Biol. Chem. 274:4115-4123[Abstract/Free Full Text].
37. LaCasse, R. A., K. E. Follis, M. Trahey, J. Scarborough, D. R. Littman, and J. H. Nunberg. 1999. Fusion-competent vaccines: broad neutralization of primary isolates of HIV. Science 283:357-362[Abstract/Free Full Text].
38. Li, Y., J. Kappes, J. Conway, R. W. Price, G. Shaw, and B. Hahn. 1991. Molecular characterization of human immunodeficiency virus type 1 cloned directly from uncultured human brain tissue: identification of replication-competent and -defective viral genomes. J. Virol. 65:3973-3985[Abstract/Free Full Text].
39. Lu, M., S. Blackow, and P. Kim. 1995. A trimeric structural domain of the HIV-1 transmembrane glycoprotein. Nat. Struct. Biol. 2:1075-1082[CrossRef][Medline].
40. Mascola, J. R., J. Louwagie, F. McCutchan, C. Fischer, P. Hegerick, K. Wagner, A. K. Fowler, J. G. McNeil, and D. S. Burke. 1994. Two antigenically distinct subtypes of human immunodeficiency virus type 1: viral genotype predicts neutralization serotype. J. Infect. Dis. 169:48-54[Medline].
41. Mascola, J. R., S. W. Snyder, O. S. Weislow, S. M. Belay, R. B. Belshe, D. H. Schwartz, M. L. Clements, R. Dolin, B. S. Graham, G. J. Gorse, M. C. Keefer, M. J. McElrath, M. C. Walker, K. F. Wagner, J. G. McNeil, F. E. McCutchan, and D. S. Burke. 1996. Immunization with envelope subunit vaccine products elicits neutralizing antibodies against laboratory-adapted but not primary isolates of human immunodeficiency virus type 1. The National Institute of Allergy and Infectious Diseases AIDS Vaccine Evaluation Group. J. Infect. Dis. 173:340-348[Medline].
42. Matthews, T. J. 1994. Dilemma of neutralization resistance of HIV-1 field isolates and vaccine development. AIDS Res. Hum. Retroviruses 10:631-632[Medline].
43. McDougal, J. S., J. K. Nicholson, G. D. Cross, S. P. Cort, M. S. Kennedy, and A. C. Mawle. 1986. Binding of the human retrovirus HTLV-III/LAV/ARV/HIV to the CD4 (T4) molecule: conformation dependence, epitope mapping, antibody inhibition, and potential for idiotypic mimicry. J. Immunol. 137:2937-2944[Abstract].
44. McKeating, J. A., A. McKnight, and J. P. Moore. 1991. Differential loss of envelope glycoprotein gp120 from virions of human immunodeficiency virus type 1 isolates: effects on infectivity and neutralization. J. Virol. 65:852-860[Abstract/Free Full Text].
45. McKeating, J., C. Shotton, J. Cordell, S. Graham, P. Balfe, N. Sullivan, M. Charles, M. Page, A. Bolmstedt, S. Olofsson, S. Kayman, Z. Wu, A. Pinter, C. Dean, J. Sodroski, and R. Weiss. 1993. Characterization of neutralizing monoclonal antibodies to linear and conformation-dependent epitopes within the first and second variable domains of human immunodeficiency virus type 1 gp120. J. Virol. 67:4932-4944[Abstract/Free Full Text].
46. Moore, J. P., J. McKeating, Y. Huang, A. Ashkenazi, and D. D. Ho. 1992. Virions of primary human immunodeficiency virus type 1 isolates resistant to soluble CD4 (sCD4) neutralization differ in sCD4 binding and glycoprotein gp120 retention from sCD4-sensitive ones. J. Virol. 66:235-243[Abstract/Free Full Text].
47. Moore, J. P., Q. J. Sattentau, H. Yoshiyama, M. Thali, M. Charles, N. Sullivan, S. W. Poon, M. S. Fung, F. Traincard, M. Pinkus, G. Robey, J. E. Robinson, D. D. Ho, and J. Sodroski. 1993. Probing the structure of the V2 domain of human immunodeficiency virus type 1 surface glycoprotein gp120 with a panel of eight monoclonal antibodies: human immune response to the V1 and V2 domains. J. Virol. 67:6136-6151[Abstract/Free Full Text].
48. Moore, J. P., and D. D. Ho. 1995. HIV-1 neutralization: the consequences of viral adaptation to growth on transformed T cells. AIDS 9(Suppl. A):S117-S136.
49. Moore, J. P., A. Trkola, B. Korber, L. Boots, J. Kessler, F. E. McCutchan, J. Mascola, D. D. Ho, J. Robinson, and A. J. Conley. 1995. A human monoclonal antibody to a complex epitope in the V3 region of gp120 of human immunodeficiency virus type 1 has broad reactivity within and outside clade B. J. Virol. 69:122-130[Abstract].
50. Moore, J. P., Y. Cao, L. Qing, Q. J. Sattentau, J. Pyati, R. Koduri, J. Robinson, C. F. Barbas III, D. R. Burton, and D. D. Ho. 1995. Primary isolates of human immunodeficiency virus type 1 are relatively resistant to neutralization by monoclonal antibodies to gp120, and their neutralization is not predicted by studies with monomeric gp120. J. Virol. 69:101-109[Abstract].
51. O'Brien, W. A., S. H. Mao, Y. Cao, and J. P. Moore. 1994. Macrophage-tropic and T-cell line-adapted chimeric strains of human immunodeficiency virus type 1 differ in their susceptibilities to neutralization by soluble CD4 at different temperatures. J. Virol. 68:5264-5269[Abstract/Free Full Text].
52. Ohno, T., M. Terada, Y. Yoneda, K. W. Shea, R. F. Chambers, D. M. Stroka, M. Nakamura, and D. W. Kufe. 1991. A broadly neutralizing monoclonal antibody that recognizes the V3 region of human immunodeficiency virus type 1 glycoprotein gp120. Proc. Natl. Acad. Sci. USA 88:10726-10729[Abstract/Free Full Text].
53. Posner, M. R., T. Hideshima, T. Cannon, M. Mukherjee, K. Mayer, and R. Byrn. 1991. An IgG human monoclonal antibody that reacts with HIV-1/GP120, inhibits virus binding to cells, and neutralizes infection. J. Immunol. 146:4325-4332[Abstract].
54. Profy, A. T., P. Salinas, L. Eckler, N. Dunlop, P. Nara, and S. D. Putney. 1990. Epitopes recognized by the neutralizing antibodies of an HIV-1-infected individuals. J. Immunol. 144:4641-4647[Abstract].
55. Rao, Z., A. S. Belyaev, E. Fry, P. Roy, I. M. Jones, and D. I. Stuart. 1995. Crystal structure of SIV matrix antigen and implications for virus assembly. Nature 378:743-74[CrossRef][Medline].
56. Robey, W. G., B. Safai, S. Oroszian, L. Q. Arthur, M. A. Gonda, R. C. Gallo, and P. J. Fischinger. 1985. Characterization of envelope and core gene products of HTLV-III with sera from AIDS patients. Science 228:593-595[Abstract/Free Full Text].
57. Rusche, J. R., D. Lynn, M. Robert-Guroff, A. Langlois, H. Lyerly, H. Carson, K. Krohn, A. Ranki, R. Gallo, D. Bolognesi, and S. Putney. 1987. Humoral immune response to the entire human immunodeficiency virus envelope glycoprotein made in insect cells. Proc. Natl. Acad. Sci. USA 84:6924-6928[Abstract/Free Full Text].
58. Rusche, J. R., K. Javaherian, C. McDanal, J. Petro, D. Lynn, R. Grimaila, A. Langlois, R. C. Gallo, L. Arthur, P. J. Fischinger, D. Bolognesi, and S. Putney. 1988. Antibodies that inhibit fusion of human immunodeficiency virus-infected cells bind a 24-amino acid sequence of the viral envelope, gp120. Proc. Natl. Acad. Sci. USA 85:3198-3202[Abstract/Free Full Text].
59. Sawyer, L. S., M. T. Wrin, L. Crawford-Miksza, B. Potts, Y. Wu, P. A. Weber, R. D. Alfonso, and C. V. Hanson. 1994. Neutralization sensitivity of human immunodeficiency virus type 1 is determined in part by the cell in which the virus is propagated. J. Virol. 68:1342-1349[Abstract/Free Full Text].
60. Schotton, C., C. Arnold, Q. Sattentau, J. Sodroski, and J. McKeating. 1995. Identification and characterization of monoclonal antibodies specific for polymorphic antigenic determinants within the V2 region of the human immunodeficiency virus type 1 envelope glycoprotein. J. Virol. 69:222-230[Abstract].
61. Schutten, M., A. McKnight, R. C. Huisman, M. Thali, J. McKeating, J. Sodroski, J. Goudsmit, and A. D. Osterhaus. 1993. Further characterization of an antigenic site of HIV-1 gp120 recognized by virus neutralizing human monoclonal antibodies. AIDS 7:919-923[Medline].
62. Schutten, M., A. C. Andeweg, M. L. Bosch, and A. D. Osterhaus. 1995. Enhancement of infectivity of a non-syncytium inducing HIV-1 by sCD4 and by human antibodies that neutralize syncytium inducing HIV-1. Scand. J. Immunol. 41:18-22[CrossRef][Medline].
63. Schutten, M., A. C. Andeweg, G. Rimmelzwaan, and A. D. Osterhaus. 1997. Modulation of primary HIV-1 envelope glycoprotein mediated entry by human antibodies. J. Gen. Virol. 78:999-1006[Abstract].
64. Sodroski, J. 1999. HIV-1 entry inhibitors in the side pocket. Cell 99:243-246[CrossRef][Medline].
65. Steimer, K. S., C. J. Scandella, P. V. Stiles, and N. L. Haigwood. 1991. Neutralization of divergent HIV-1 isolates by conformation-dependent human antibodies to Gp120. Science 254:105-108[Abstract/Free Full Text].
66. Sullivan, N., Y. Sun, J. Li, W. Hofmann, and J. Sodroski. 1995. Replicative function and neutralization sensitivity of envelope glycoproteins from primary and T-cell line-passaged human immunodeficiency virus type 1 isolates. J. Virol. 69:4413-4422[Abstract].
67. Sullivan, N., Y. Sun, J. Binley, J. Lee, C. F. Barbas III, P. W. Parren, D. R. Burton, and J. Sodroski. 1998. Determinants of human immunodeficiency virus type 1 envelope glycoprotein activation by soluble CD4 and monoclonal antibodies. J. Virol. 72:6332-6338[Abstract/Free Full Text].
68. Sullivan, N., Y. Sun, Q. Sattentau, M. Thali, D. Wu, G. Denisova, J. Gershoni, J. Robinson, J. Moore, and J. Sodroski. 1998. CD4-induced conformational changes in the human immunodeficiency virus type 1 gp120 glycoprotein: consequences for virus entry and neutralization. J. Virol. 72:4694-4703[Abstract/Free Full Text].
69. Tan, K., J.-H. Lee, J.-H. Wang, S. Shen, and M. Lu. 1997. Atomic structure of a thermostable subdomain of HIV-1 gp41. Proc. Natl. Acad. Sci. USA 94:12303-12308[Abstract/Free Full Text].
70. Thali, M., U. Olshevsky, C. Furman, D. Gabuzda, M. Posner, and J. Sodroski. 1991. Characterization of a discontinuous human immunodeficiency virus type 1 gp120 epitope recognized by a broadly reactive neutralizing human monoclonal antibody. J. Virol. 65:6188-6193[Abstract/Free Full Text].
71. Thali, M., C. Furman, D. D. Ho, J. Robinson, S. Tilley, A. Pinter, and J. Sodroski. 1992. Discontinuous, conserved neutralization epitopes overlapping the CD4-binding region of human immunodeficiency virus type 1 gp120 envelope glycoprotein. J. Virol. 66:5635-5641[Abstract/Free Full Text].
72. Thali, M., J. P. Moore, C. Furman, M. Charles, D. D. Ho, J. Robinson, and J. Sodroski. 1993. Characterization of conserved human immunodeficiency virus type 1 gp120 neutralization epitopes exposed upon gp120-CD4 binding. J. Virol. 67:3978-3988[Abstract/Free Full Text].
73. Tilley, S. A., W. J. Honnen, M. Racho, M. Hilgartner, and A. Pinter. 1991. A human monoclonal antibody against the CD4-binding site of HIV-1 gp120 exhibits potent, broadly neutralizing activity. Res. Virol. 142:247-259[CrossRef][Medline].
74. Trkola, A., T. Dragic, J. Arthos, J. M. Binley, W. C. Olson, G. P. Allaway, C. Cheng-Mayer, J. Robinson, P. J. Maddon, and J. P. Moore. 1996. CD4-dependent, antibody-sensitive interactions between HIV-1 and its co-receptor CCR-5. Nature 384:184-187[CrossRef][Medline].
75. VanCott, T. C., J. R. Mascola, R. W. Kaminski, V. Kalyaraman, P. L. Hallberg, P. R. Burnett, J. T. Ulrich, D. J. Rechtman, and D. L. Birx. 1997. Antibodies with specificity to native gp120 and neutralization activity against primary human immunodeficiency virus type 1 isolates elicited by immunization with oligomeric gp160. J. Virol. 71:4319-4330[Abstract].
76. VanCott, T. C., J. R. Mascola, L. D. Loomis-Price, F. Sinangil, N. Zitomersky, J. McNeil, M. L. Robb, D. L. Birx, and S. Barnett. 1999. Cross-subtype neutralizing antibodies induced in baboons by a subtype E gp120 immunogen based on an R5 primary human immunodeficiency virus type 1 envelope. J. Virol. 73:4640-4650[Abstract/Free Full Text].
77. Veronese, F. D., A. L. DeVico, T. D. Copeland, S. Oroszlan, R. S. Gallo, and M. G. Sarngadharan. 1985. Characterization of gp41 as the transmembrane protein coded by the HTLV-III/LAV envelope gene. Science 229:1402-1405[Abstract/Free Full Text].
78. Weissenhorn, W., A. Dessen, S. C. Harrison, J. J. Skehel, and D. C. Wiley. 1997. Atomic structure of the ectodomain from HIV-1 gp41. Nature 387:426-430[CrossRef][Medline].
79. Wrin, T., and J. H. Nunberg. 1994. HIV-1 MN recombinant gp120 vaccine serum, which fails to neutralize primary isolates of HIV-1, does not antagonize neutralization by antibodies from infected individuals. AIDS 8:1622-1623[CrossRef][Medline].
80. Wrin, T., T. P. Loh, J. C. Vennari, H. Schuitemaker, and J. H. Nunberg. 1995. Adaptation to persistent growth in the H9 cell line renders a primary isolate of human immunodeficiency virus type 1 sensitive to neutralization by vaccine sera. J. Virol. 69:39-48[Abstract].
81. Wu, L., N. P. Gerard, R. Wyatt, H. Choe, C. Parolin, N. Ruffing, A. Borsetti, A. A. Cardoso, E. Desjardins, W. Newman, C. Gerard, and J. Sodroski. 1996. CD4-induced interaction of primary HIV-1 gp120 glycoproteins with the chemokine receptor CCR-5. Nature 384:179-183[CrossRef][Medline].
82. Wyatt, R., and J. Sodroski. 1998. The human immunodeficiency virus (HIV-1) envelope glycoproteins: fusogens, antigens and immunogens. Science 280:1884-1888[Abstract/Free Full Text].
83. Wyatt, R., P. D. Kwong, E. Desjardins, R. W. Sweet, J. Robinson, W. A. Hendrickson, and J. G. Sodroski. 1998. The antigenic structure of the HIV gp120 envelope glycoprotein. Nature 393:705-711[CrossRef][Medline].
84. Yang, X., L. Florin, M. Farzan, P. Kolchinsky, P. Kwong, J. Sodroski, and R. Wyatt. 1999. Modifications that stabilize human immunodeficiency virus envelope glycoproteins trimers in solution. J. Virol. 74:4746-4754[Abstract/Free Full Text].
85. Yang, X., M. Farzan, R. Wyatt, and J. Sodroski. 2000. Characterization of stable, soluble trimers containing the complete ectodomains of the human immunodeficiency virus type 1 envelope glycoproteins. J. Virol. 74:5716-5725[Abstract/Free Full Text].
86. Zhang, Y., R. Fredriksson, J. McKeating, and E. M. Fenyo. 1997. Passage of HIV-1 molecular clones into different cells lines confers differential sensitivity to neutralization. Virology 238:254-264[CrossRef][Medline].


Journal of Virology, February 2001, p. 1165-1171, Vol. 75, No. 3
0022-538X/01/$04.00+0   DOI: 10.1128/JVI.75.3.1165-1171.2001
Copyright © 2001, American Society for Microbiology. All rights reserved.



This article has been cited by other articles:

  • Gray, L., Roche, M., Churchill, M. J., Sterjovski, J., Ellett, A., Poumbourios, P., Sheffief, S., Wang, B., Saksena, N., Purcell, D. F. J., Wesselingh, S., Cunningham, A. L., Brew, B. J., Gabuzda, D., Gorry, P. R. (2009). Tissue-Specific Sequence Alterations in the Human Immunodeficiency Virus Type 1 Envelope Favoring CCR5 Usage Contribute to Persistence of Dual-Tropic Virus in the Brain. J. Virol. 83: 5430-5441 [Abstract] [Full Text]  
  • Morner, A., Douagi, I., Forsell, M. N. E., Sundling, C., Dosenovic, P., O'Dell, S., Dey, B., Kwong, P. D., Voss, G., Thorstensson, R., Mascola, J. R., Wyatt, R. T., Karlsson Hedestam, G. B. (2009). Human Immunodeficiency Virus Type 1 Env Trimer Immunization of Macaques and Impact of Priming with Viral Vector or Stabilized Core Protein. J. Virol. 83: 540-551 [Abstract] [Full Text]  
  • Bontjer, I., Land, A., Eggink, D., Verkade, E., Tuin, K., Baldwin, C., Pollakis, G., Paxton, W. A., Braakman, I., Berkhout, B., Sanders, R. W. (2009). Optimization of Human Immunodeficiency Virus Type 1 Envelope Glycoproteins with V1/V2 Deleted, Using Virus Evolution. J. Virol. 83: 368-383 [Abstract] [Full Text]  
  • Doria-Rose, N. A., Klein, R. M., Manion, M. M., O'Dell, S., Phogat, A., Chakrabarti, B., Hallahan, C. W., Migueles, S. A., Wrammert, J., Ahmed, R., Nason, M., Wyatt, R. T., Mascola, J. R., Connors, M. (2009). Frequency and Phenotype of Human Immunodeficiency Virus Envelope-Specific B Cells from Patients with Broadly Cross-Neutralizing Antibodies. J. Virol. 83: 188-199 [Abstract] [Full Text]  
  • Forsman, A., Beirnaert, E., Aasa-Chapman, M. M. I., Hoorelbeke, B., Hijazi, K., Koh, W., Tack, V., Szynol, A., Kelly, C., McKnight, A., Verrips, T., Haard, H. d., Weiss, R. A. (2008). Llama Antibody Fragments with Cross-Subtype Human Immunodeficiency Virus Type 1 (HIV-1)-Neutralizing Properties and High Affinity for HIV-1 gp120. J. Virol. 82: 12069-12081 [Abstract] [Full Text]  
  • Sundling, C., Schon, K., Morner, A., Forsell, M. N. E., Wyatt, R. T., Thorstensson, R., Hedestam, G. B. K., Lycke, N. Y. (2008). CTA1-DD adjuvant promotes strong immunity against human immunodeficiency virus type 1 envelope glycoproteins following mucosal immunization. J. Gen. Virol. 89: 2954-2964 [Abstract] [Full Text]  
  • Kraft, Z., Strouss, K., Sutton, W. F., Cleveland, B., Tso, F. Y., Polacino, P., Overbaugh, J., Hu, S.-L., Stamatatos, L. (2008). Characterization of Neutralizing Antibody Responses Elicited by Clade A Envelope Immunogens Derived from Early Transmitted Viruses. J. Virol. 82: 5912-5921 [Abstract] [Full Text]  
  • Lobo, P. I., Schlegel, K. H., Yuan, W., Townsend, G. C., White, J. A. (2008). Inhibition of HIV-1 Infectivity through an Innate Mechanism Involving Naturally Occurring IgM Anti-Leukocyte Autoantibodies. J. Immunol. 180: 1769-1779 [Abstract] [Full Text]  
  • Ching, L. K., Vlachogiannis, G., Bosch, K. A., Stamatatos, L. (2008). The First Hypervariable Region of the gp120 Env Glycoprotein Defines the Neutralizing Susceptibility of Heterologous Human Immunodeficiency Virus Type 1 Isolates to Neutralizing Antibodies Elicited by the SF162gp140 Immunogen. J. Virol. 82: 949-956 [Abstract] [Full Text]  
  • Blay, W. M., Kasprzyk, T., Misher, L., Richardson, B. A., Haigwood, N. L. (2007). Mutations in Envelope gp120 Can Impact Proteolytic Processing of the gp160 Precursor and Thereby Affect Neutralization Sensitivity of Human Immunodeficiency Virus Type 1 Pseudoviruses. J. Virol. 81: 13037-13049 [Abstract] [Full Text]  
  • Forsell, M. N. E., McInerney, G. M., Dosenovic, P., Hidmark, A. S., Eriksson, C., Liljestrom, P., Grundner, C., Karlsson Hedestam, G. B. (2007). Increased human immunodeficiency virus type 1 Env expression and antibody induction using an enhanced alphavirus vector. J. Gen. Virol. 88: 2774-2779 [Abstract] [Full Text]  
  • Buonaguro, L., Tornesello, M. L., Buonaguro, F. M. (2007). Human Immunodeficiency Virus Type 1 Subtype Distribution in the Worldwide Epidemic: Pathogenetic and Therapeutic Implications. J. Virol. 81: 10209-10219 [Full Text]  
  • Derby, N. R., Kraft, Z., Kan, E., Crooks, E. T., Barnett, S. W., Srivastava, I. K., Binley, J. M., Stamatatos, L. (2006). Antibody Responses Elicited in Macaques Immunized with Human Immunodeficiency Virus Type 1 (HIV-1) SF162-Derived gp140 Envelope Immunogens: Comparison with Those Elicited during Homologous Simian/Human Immunodeficiency Virus SHIVSF162P4 and Heterologous HIV-1 Infection.. J. Virol. 80: 8745-8762 [Abstract] [Full Text]  
  • Gray, L., Churchill, M. J., Keane, N., Sterjovski, J., Ellett, A. M., Purcell, D. F. J., Poumbourios, P., Kol, C., Wang, B., Saksena, N. K., Wesselingh, S. L., Price, P., French, M., Gabuzda, D., Gorry, P. R. (2006). Genetic and Functional Analysis of R5X4 Human Immunodeficiency Virus Type 1 Envelope Glycoproteins Derived from Two Individuals Homozygous for the CCR5{Delta}32 Allele.. J. Virol. 80: 3684-3691 [Abstract] [Full Text]  
  • Li, Y., Svehla, K., Mathy, N. L., Voss, G., Mascola, J. R., Wyatt, R. (2006). Characterization of Antibody Responses Elicited by Human Immunodeficiency Virus Type 1 Primary Isolate Trimeric and Monomeric Envelope Glycoproteins in Selected Adjuvants. J. Virol. 80: 1414-1426 [Abstract] [Full Text]  
  • Hammonds, J., Chen, X., Fouts, T., DeVico, A., Montefiori, D., Spearman, P. (2005). Induction of Neutralizing Antibodies against Human Immunodeficiency Virus Type 1 Primary Isolates by Gag-Env Pseudovirion Immunization. J. Virol. 79: 14804-14814 [Abstract] [Full Text]  
  • Selvarajah, S., Puffer, B., Pantophlet, R., Law, M., Doms, R. W., Burton, D. R. (2005). Comparing Antigenicity and Immunogenicity of Engineered gp120. J. Virol. 79: 12148-12163 [Abstract] [Full Text]  
  • Forsell, M. N. E., Li, Y., Sundback, M., Svehla, K., Liljestrom, P., Mascola, J. R., Wyatt, R., Hedestam, G. B. K. (2005). Biochemical and Immunogenic Characterization of Soluble Human Immunodeficiency Virus Type 1 Envelope Glycoprotein Trimers Expressed by Semliki Forest Virus. J. Virol. 79: 10902-10914 [Abstract] [Full Text]  
  • Pancera, M., Lebowitz, J., Schon, A., Zhu, P., Freire, E., Kwong, P. D., Roux, K. H., Sodroski, J., Wyatt, R. (2005). Soluble Mimetics of Human Immunodeficiency Virus Type 1 Viral Spikes Produced by Replacement of the Native Trimerization Domain with a Heterologous Trimerization Motif: Characterization and Ligand Binding Analysis. J. Virol. 79: 9954-9969 [Abstract] [Full Text]  
  • Beddows, S., Schulke, N., Kirschner, M., Barnes, K., Franti, M., Michael, E., Ketas, T., Sanders, R. W., Maddon, P. J., Olson, W. C., Moore, J. P. (2005). Evaluating the Immunogenicity of a Disulfide-Stabilized, Cleaved, Trimeric Form of the Envelope Glycoprotein Complex of Human Immunodeficiency Virus Type 1. J. Virol. 79: 8812-8827 [Abstract] [Full Text]  
  • Yang, X., Kurteva, S., Lee, S., Sodroski, J. (2005). Stoichiometry of Antibody Neutralization of Human Immunodeficiency Virus Type 1. J. Virol. 79: 3500-3508 [Abstract] [Full Text]  
  • Yang, X., Tomov, V., Kurteva, S., Wang, L., Ren, X., Gorny, M. K., Zolla-Pazner, S., Sodroski, J. (2004). Characterization of the Outer Domain of the gp120 Glycoprotein from Human Immunodeficiency Virus Type 1. J. Virol. 78: 12975-12986 [Abstract] [Full Text]  
  • Yuan, W., Craig, S., Si, Z., Farzan, M., Sodroski, J. (2004). CD4-Induced T-20 Binding to Human Immunodeficiency Virus Type 1 gp120 Blocks Interaction with the CXCR4 Coreceptor. J. Virol. 78: 5448-5457 [Abstract] [Full Text]  
  • Bower, J. F., Yang, X., Sodroski, J., Ross, T. M. (2004). Elicitation of Neutralizing Antibodies with DNA Vaccines Expressing Soluble Stabilized Human Immunodeficiency Virus Type 1 Envelope Glycoprotein Trimers Conjugated to C3d. J. Virol. 78: 4710-4719 [Abstract] [Full Text]  
  • McKenna, P. M., Pomerantz, R. J., Dietzschold, B., McGettigan, J. P., Schnell, M. J. (2003). Covalently Linked Human Immunodeficiency Virus Type 1 gp120/gp41 Is Stably Anchored in Rhabdovirus Particles and Exposes Critical Neutralizing Epitopes. J. Virol. 77: 12782-12794 [Abstract] [Full Text]  
  • Srivastava, I. K., Stamatatos, L., Kan, E., Vajdy, M., Lian, Y., Hilt, S., Martin, L., Vita, C., Zhu, P., Roux, K. H., Vojtech, L., C. Montefiori, D., Donnelly, J., Ulmer, J. B., Barnett, S. W. (2003). Purification, Characterization, and Immunogenicity of a Soluble Trimeric Envelope Protein Containing a Partial Deletion of the V2 Loop Derived from SF162, an R5-Tropic Human Immunodeficiency Virus Type 1 Isolate. J. Virol. 77: 11244-11259 [Abstract] [Full Text]  
  • Green, T. D., Montefiori, D. C., Ross, T. M. (2003). Enhancement of Antibodies to the Human Immunodeficiency Virus Type 1 Envelope by Using the Molecular Adjuvant C3d. J. Virol. 77: 2046-2055 [Abstract] [Full Text]  
  • Sanders, R. W., Vesanen, M., Schuelke, N., Master, A., Schiffner, L., Kalyanaraman, R., Paluch, M., Berkhout, B., Maddon, P. J., Olson, W. C., Lu, M., Moore, J. P. (2002). Stabilization of the Soluble, Cleaved, Trimeric Form of the Envelope Glycoprotein Complex of Human Immunodeficiency Virus Type 1. J. Virol. 76: 8875-8889 [Abstract] [Full Text]  
  • Schulke, N., Vesanen, M. S., Sanders, R. W., Zhu, P., Lu, M., Anselma, D. J., Villa, A. R., Parren, P. W. H. I., Binley, J. M., Roux, K. H., Maddon, P. J., Moore, J. P., Olson, W. C. (2002). Oligomeric and Conformational Properties of a Proteolytically Mature, Disulfide-Stabilized Human Immunodeficiency Virus Type 1 gp140 Envelope Glycoprotein. J. Virol. 76: 7760-7776 [Abstract] [Full Text]  
  • Giannecchini, S., Isola, P., Sichi, O., Matteucci, D., Pistello, M., Zaccaro, L., Del Mauro, D., Bendinelli, M. (2002). AIDS Vaccination Studies Using an Ex Vivo Feline Immunodeficiency Virus Model: Failure To Protect and Possible Enhancement of Challenge Infection by Four Cell-Based Vaccines Prepared with Autologous Lymphoblasts. J. Virol. 76: 6882-6892 [Abstract] [Full Text]  
  • Liu, J., Wang, S., Hoxie, J. A., LaBranche, C. C., Lu, M. (2002). Mutations That Destabilize the gp41 Core Are Determinants for Stabilizing the Simian Immunodeficiency Virus-CPmac Envelope Glycoprotein Complex. J. Biol. Chem. 277: 12891-12900 [Abstract] [Full Text]  
  • Yang, X., Lee, J., Mahony, E. M., Kwong, P. D., Wyatt, R., Sodroski, J. (2002). Highly Stable Trimers Formed by Human Immunodeficiency Virus Type 1 Envelope Glycoproteins Fused with the Trimeric Motif of T4 Bacteriophage Fibritin. J. Virol. 76: 4634-4642 [Abstract] [Full Text]  
  • Grundner, C., Mirzabekov, T., Sodroski, J., Wyatt, R. (2002). Solid-Phase Proteoliposomes Containing Human Immunodeficiency Virus Envelope Glycoproteins. J. Virol. 76: 3511-3521 [Abstract] [Full Text]  
  • Jin, X., Ramanathan, M. Jr., Barsoum, S., Deschenes, G. R., Ba, L., Binley, J., Schiller, D., Bauer, D. E., Chen, D. C., Hurley, A., Gebuhrer, L., El Habib, R., Caudrelier, P., Klein, M., Zhang, L., Ho, D. D., Markowitz, M. (2002). Safety and Immunogenicity of ALVAC vCP1452 and Recombinant gp160 in Newly Human Immunodeficiency Virus Type 1-Infected Patients Treated with Prolonged Highly Active Antiretroviral Therapy. J. Virol. 76: 2206-2216 [Abstract] [Full Text]  
  • Binley, J. M., Sanders, R. W., Master, A., Cayanan, C. S., Wiley, C. L., Schiffner, L., Travis, B., Kuhmann, S., Burton, D. R., Hu, S.-L., Olson, W. C., Moore, J. P. (2002). Enhancing the Proteolytic Maturation of Human Immunodeficiency Virus Type 1 Envelope Glycoproteins. J. Virol. 76: 2606-2616 [Abstract] [Full Text]  
  • Srivastava, I. K., Stamatatos, L., Legg, H., Kan, E., Fong, A., Coates, S. R., Leung, L., Wininger, M., Donnelly, J. J., Ulmer, J. B., Barnett, S. W. (2002). Purification and Characterization of Oligomeric Envelope Glycoprotein from a Primary R5 Subtype B Human Immunodeficiency Virus. J. Virol. 76: 2835-2847 [Abstract] [Full Text]  
  • Barnett, S. W., Lu, S., Srivastava, I., Cherpelis, S., Gettie, A., Blanchard, J., Wang, S., Mboudjeka, I., Leung, L., Lian, Y., Fong, A., Buckner, C., Ly, A., Hilt, S., Ulmer, J., Wild, C. T., Mascola, J. R., Stamatatos, L. (2001). The Ability of an Oligomeric Human Immunodeficiency Virus Type 1 (HIV-1) Envelope Antigen To Elicit Neutralizing Antibodies against Primary HIV-1 Isolates Is Improved following Partial Deletion of the Second Hypervariable Region. J. Virol. 75: 5526-5540 [Abstract] [Full Text]  

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.