This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.

 Previous Article  |  Next Article 

Journal of Virology, June 2000, p. 5716-5725, Vol. 74, No. 12
0022-538X/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.

Characterization of Stable, Soluble Trimers Containing Complete Ectodomains of Human Immunodeficiency Virus Type 1 Envelope Glycoproteins

Xinzhen Yang,1,2 Michael Farzan,1,2 Richard Wyatt,1,3 and Joseph Sodroski1,2,4,*

Department of Cancer Immunology and AIDS, Dana-Farber Cancer Institute,1 Department of Pathology2 and Department of Medicine,3 Harvard Medical School, and Department of Immunology and Infectious Diseases, Harvard School of Public Health,4 Boston, Massachusetts 02115

Received 22 December 1999/Accepted 23 March 2000


    ABSTRACT
Top
Abstract
Text
References

The human immunodeficiency virus type 1 (HIV-1) envelope glycoproteins function as a membrane-anchored trimer of three gp120 exterior glycoproteins and three gp41 transmembrane glycoproteins. Previously, we reported three approaches to stabilize soluble trimers containing parts of the gp41 ectodomains: addition of GCN4 trimeric helices, disruption of the cleavage site between gp120 and gp41, and introduction of cysteines in the gp41 coiled coil to form intersubunit disulfide bonds. Here, we applied similar approaches to stabilize soluble gp140 trimers including the complete gp120 and gp41 ectodomains. A combination of fusion with the GCN4 trimeric sequences and disruption of the gp120-gp41 cleavage site resulted in relatively homogeneous gp140 trimers with exceptional stability. The gp120 epitopes recognized by neutralizing antibodies are intact and exposed on these gp140 trimers. By contrast, the nonneutralizing antibody epitopes on the gp120 subunits of the soluble trimers are relatively occluded compared with those on monomeric gp120 preparations. This antigenic similarity to the functional HIV-1 envelope glycoproteins and the presence of the complete gp41 ectodomain should make the soluble gp140 trimers useful tools for structural and immunologic studies.


    TEXT
Top
Abstract
Text
References

The human immunodeficiency virus type 1 (HIV-1) glycoproteins are initially synthesized as a polyprotein precursor that undergoes posttranslational modifications including glycosylation, oligomerization, and proteolytic cleavage between the gp120 and gp41 subunits (2, 18, 47, 53). The mature envelope glycoproteins are transported to the cell surface, where they are incorporated into the virus as an oligomeric complex. The preponderance of evidence indicates that the mature oligomer consists of and functions as a trimer of gp120-gp41 heterodimers (7, 20, 36, 46, 48, 54). The envelope glycoprotein complex promotes viral entry into host cells by binding cellular receptors and mediating the fusion of the viral and cellular membranes (1, 10, 12-15, 32, 38, 50). The gp120 exterior envelope glycoprotein binds the CD4 molecule, which facilitates the interaction of gp120 with a second receptor (typically, the chemokine receptor CCR5 or CXCR4). The interactions between gp120 and the cellular receptor molecules are believed to trigger conformational changes in the envelope glycoprotein complex important for the membrane fusion process. Mutagenic analyses and structural studies point to a pivotal role of the gp41 ectodomain in the fusion process (8, 9, 22, 38, 48, 54). Two potential alpha-helical regions, designated N36 and C34, in the gp41 ectodomain have been shown to form a stable six-helix bundle (9, 48, 54). This bundle, which is believed to represent the final, fusogenic conformation of gp41, consists of three C34 helices packed into the hydrophobic grooves on the outer surface of a trimeric N36 coiled coil. Because C34-like peptides can efficiently block HIV-1 envelope glycoprotein-mediated membrane fusion, a gp41 conformational intermediate in which the grooves in the N36 coiled coil are not occupied by C34 helices has been proposed (23, 31, 55). Of the several conformational states assumed by the HIV-1 envelope glycoproteins during the virus entry process, detailed structural data are available only on a CD4-bound form of gp120 and the gp41 six-helix bundle (9, 35, 48, 54). Additional information on the other conformations, particularly that associated with the virion trimer prior to receptor binding, would be extremely valuable in guiding attempts at pharmacologic and immunologic intervention.

Most antibodies elicited against the HIV-1 envelope glycoproteins during natural infection or after vaccination are incapable of neutralizing HIV-1 infectivity in vitro (6, 25, 37, 40, 45, 57). While several such antibodies effectively neutralize viruses that are adapted to replicate in immortalized T-cell lines, only three monoclonal antibodies, IgG1b12, 2G12, and 2F5, neutralize a wide range of primary HIV-1 isolates (7, 43, 50). These three monoclonal antibodies exhibit a higher affinity for oligomeric HIV-1 envelope glycoproteins on viruses or cell surfaces than do most antibodies directed against the envelope glycoproteins (44, 45). To date, most recombinant HIV-1 glycoproteins tested as vaccine candidates have been gp120 monomers. The antibody responses to gp120 are not usually effective in neutralizing primary HIV-1 isolates (3, 4, 9, 25, 37, 52, 57). To attempt to mimic the native HIV-1 envelope glycoprotein oligomer, soluble gp140 glycoproteins containing gp120 and the gp41 ectodomains have been created (6, 16, 17). When the gp120-gp41 junction is modified to reduce proteolytic cleavage, these soluble gp140 glycoproteins assemble into dimers and tetramers in addition to the monomeric forms (6, 16, 17, 51). The elicitation of neutralizing antibodies by oligomeric forms of soluble gp140 has been disappointing, perhaps because these oligomers do not fully resemble the biologically relevant envelope glycoprotein trimers (16, 51).

Attempts to produce HIV-1 envelope glycoprotein trimers for structural and immunologic analysis have been frustrated by the lability of these glycoprotein complexes. Both the intersubunit interactions that promote trimer formation and the association between gp120 and gp41 are labile (24, 39). Modifications of the gp120-gp41 cleavage site and introduction of cysteine cross-links between gp120 and gp41 have been employed to address the latter problem (5, 17). However, as alluded to above, these approaches do not deal with the instability of the oligomeric associations or with the tendency of the HIV-1 envelope glycoprotein ectodomains to form dimers and tetramers. Two strategies for stabilizing trimeric interactions among HIV-1 envelope glycoprotein subunits have been devised (20, 60). The first strategy involves the introduction of cysteine residues into the gp41 N36 coiled coil, allowing the formation of disulfide bonds between the monomeric subunits (20). This approach results in the cross-linking of the membrane-anchored gp160 envelope glycoprotein precursor only when the cysteines are positioned along the N36 coiled coil in locations that allow disulfide bond formation in the context of a trimer. These cysteines are not sufficient to stabilize soluble forms of the HIV-1 envelope glycoproteins, probably because the lability of the soluble trimer is such that disulfide bonds do not have an opportunity to form (X. Yang, et al., unpublished data). The second strategy is the addition of a trimeric GCN4 motif to the carboxyl terminus of the soluble envelope glycoproteins (26, 60). In initial studies, these helical GCN4 sequences were added in register with the N36 helices, presumably extending the trimeric gp41 coiled coil and thus enhancing the stability of the trimer (60). Particularly when gp120-gp41 cleavage was eliminated, these soluble gp130 glycoproteins containing GCN4 sequences formed relatively stable and homogeneous trimers. In these molecules, introduction of cysteines into appropriate locations in the N36 coiled coil resulted in intersubunit disulfide bonds and even greater stability of the trimers. Although these soluble gp130 trimers may be useful for some studies, they lack gp41 ectodomain structures that are thought to play a role in the function and antigenicity of the HIV-1 envelope glycoproteins. One example is the disulfide-linked loop at positions 598 to 604 of gp41, which probably contributes to noncovalent interactions with the first (C1) or fifth (C5) conserved region of the gp120 glycoprotein (8, 27). A second example is the heavily glycosylated gp41 region from residues 611 to 637. This region is longer in the transmembrane envelope glycoproteins of lentiviruses than it is in those of other retroviruses, consistent with a potential role in immune evasion. A third example is the gp41 C34 helix, which is an integral part of the six-helix bundle thought to mediate virus-cell membrane fusion (9, 48, 54). Finally, the deleted regions in the soluble gp130 trimers encompass almost all of the major gp41 epitopes, including that recognized by the 2F5 neutralizing antibody (16, 43).

In this study, we used combinations of the three approaches described above (addition of trimeric GCN4 helices, modification of the gp120-gp41 cleavage site, and introduction of cysteines into the gp41 N36 region) to create stable, soluble gp140 trimers containing most or all of the gp41 ectodomain. Figure 1A shows the composition of the soluble glycoproteins used in this study. In the nomenclature used herein, "gp140" refers to an HIV-1 envelope glycoprotein (YU2 strain) truncated near the carboxyl terminus of the gp41 ectodomain. A minus sign in the parentheses after a construct name indicates the presence of arginine-to-serine changes at residues 508 and 511, which impair proteolytic cleavage between gp120 and gp41 sequences (60). "CCG" in the parentheses indicates the substitution of two cysteines and a glycine for residues 576 to 578, which substitution has been shown to allow disulfide cross-linking of HIV-1 envelope glycoprotein trimers (20, 60). "GCN4" in the parentheses indicates the addition of the trimeric GCN4 sequence (MKQIEDKIEEILSKIYHIENEIARIKKLIGEV) to the carboxyl terminus of the glycoprotein.


View larger version (47K):
[in this window]
[in a new window]
 
FIG. 1.   Characterization of the soluble gp140 envelope glycoproteins. (A) Soluble HIV-1 envelope glycoprotein constructs. The expression plasmids were based on the pSVIIIenv plasmid containing the env gene of the HIV-1 YU2 strain. The plasmids expressing gp120, gp140(-) and gp130(-/GCN4) have been described previously (60). The gp140(-) glycoprotein is terminated after leucine 669 and contains arginine-to-serine substitutions at positions 508 and 511 (SS), disrupting the proteolytic cleavage site between gp120 and gp41. Previous studies indicated that the oligomerization of this gp140(-) construct is similar to that of soluble glycoprotein constructs containing the entire gp41 ectodomain (19). The gp130(-/GCN4) glycoprotein contains the same substitutions at the gp120-gp41 cleavage site and contains a GCN4 trimeric motif carboxy terminal to leucine 580. The four gp140 derivatives at the bottom of the panel have trimeric GCN4 sequences placed immediately after isoleucine 675. Some of these, in addition, contain alterations of the gp120-gp41 cleavage site and/or the CCG substitution at positions 576 to 578. The gp140 constructs were made with the QuickChange kit (Stratagene), and the entire env gene of the mutants was sequenced to verify the presence of only the intended changes. The amino acid residues of the constructs are numbered according to the prototypic HXBc2 sequence, in accordance with the current convention (33). (B) Radiolabeled envelope glycoproteins were precipitated for 3 h at room temperature by an excess of pooled sera (3 µl) from HIV-1-infected individuals and 10% (wt/vol) protein A-Sepharose beads (Pharmacia). The beads were washed three times with phosphate-buffered saline (PBS), boiled for 3 min in Laemmli sample buffer, and loaded onto an SDS-7.5% polyacrylamide gel. The positions of monomeric and presumed trimeric forms of several of the glycoproteins are indicated. Mock, control cells transfected with an irrelevant plasmid. Molecular size markers are shown at the left. (C) Radiolabeled envelope glycoproteins were precipitated as described for panel B, except that the precipitates were boiled for 3 min in Laemmli sample buffer containing 2% beta -ME. (D) Lanes 1 to 10, radiolabeled envelope glycoproteins analyzed on 10 to 25% sucrose density gradients, with fraction 1 collected from the bottom of the gradient and fraction 10 collected from the top of the gradient. Fractions were precipitated by a mixture of sera from HIV-1-infected individuals. Precipitates were analyzed on SDS-polyacrylamide gels under reducing conditions. (E) The YU2 gp120 and gp140(-/GCN4) glycoproteins were purified from transfected 293T cell supernatants by an F105 antibody affinity column. The glycoproteins were eluted in 3 M MgCl2 and then dialyzed against 100 volumes of PBS. The purified glycoproteins were run on an SDS-polyacrylamide gel and then stained with Coomassie blue (left panel). Approximately 10 µg of the purified glycoproteins was then analyzed on a Superdex 200 column and compared with molecular weight standards, the positions of which are indicated by arrows. Elution times are also shown. The aggregate peak for the gp140(-/GCN4) glycoprotein elutes before the largest molecular size standard used (669 kDa).

To examine the expression and properties of these soluble gp140 glycoproteins, transfected 293T cells transiently expressing these proteins were radiolabeled with 35S-methionine and 35S-cysteine. The cell supernatants were precipitated with 3 µl of pooled sera from HIV-1-infected individuals, and the precipitated proteins were resolved on a sodium dodecyl sulfate (SDS)-7.5% polyacrylamide gel after boiling for 3 min in 1× Laemmli sample buffer. As shown in Fig. 1B, the gp120 and gp140(-) glycoproteins migrated on the gel mainly as monomers. A small amount of dimeric gp140(-) glycoprotein was visible under these conditions. The addition of the trimeric GCN4 sequences resulted in the production of high-molecular-weight forms of the soluble gp140 glycoproteins that remained stable even after boiling and electrophoresis. These higher-order species migrated with an apparent molecular mass of approximately 400 kDa, based on extrapolation from the migration of the molecular weight markers and the apparent dimeric forms of the glycoproteins. Under identical conditions, the soluble gp130(-/GCN4) glycoprotein migrated primarily as a monomer, indicating that the soluble gp140 oligomers are more stable than the previously described soluble gp130 trimers (60). The soluble gp140 glycoproteins with a proteolytic cleavage site modification [gp140(-/GCN4) and gp140(-/CCG/GCN4)] exhibited few or no monomeric forms on the gel. The gp140(GCN4) and gp140(CCG/GCN4) glycoproteins, which contain an intact gp120-gp41 proteolytic cleavage site, were resolved into both oligomeric and monomeric forms. Significantly, the monomeric forms of the gp140(GCN4) and gp140(CCG/GCN4) glycoproteins migrated comparably to gp120, not gp140. This result suggests that the proteolytically cleaved soluble gp140 oligomers are less stable than the uncleaved forms of the same glycoprotein. Consistent with this interpretation, when the oligomeric forms of gp140(GCN4) and gp140(CCG/GCN4) glycoproteins were disrupted by being heated to 100°C for 8 min in sample buffer containing 5% beta -mercaptoethanol (beta -ME), they migrated alongside the gp140(-) glycoprotein (data not shown). Thus, as was previously observed for soluble gp130 trimers (60), elimination of gp120-gp41 cleavage contributes to the stability of the soluble oligomer.

To investigate whether intersubunit disulfide bonds formed in the gp140(-/CCG/GCN4) glycoprotein, compared with the negative and positive control glycoproteins [gp140(-/GCN4) and gp130(-/CCG/GCN4), respectively], the proteins were analyzed after boiling in sample buffer containing 2% beta -ME. Under these reducing conditions, both the oligomeric gp140(-/CCG/GCN4) and gp130(-/CCG/GCN4) glycoproteins were more stable than the gp140(-/GCN4) oligomers (Fig. 1C). This result is consistent with the formation of intersubunit disulfide bonds in at least some of the gp140(-/CCG/GCN4) glycoproteins.

To analyze the soluble gp140 glycoproteins under conditions more gentle than those described above, the radiolabeled glycoproteins were concentrated and resolved by velocity centrifugation in 10 ml of 10 to 25% continuous sucrose gradients. Ten fractions were collected from each gradient, and the envelope glycoproteins in each fraction were detected by precipitation by pooled sera from HIV-1-infected individuals. The precipitates were analyzed on reducing SDS-polyacrylamide gels. As shown in Fig. 1D, the gp140(-) glycoprotein sedimented in fractions 4 to 8, with the majority of the protein in fractions 6 and 7. The uncleaved portion of the gp130(-/GCN4) glycoprotein, which has been shown to be trimeric and was included as a positive control, sedimented in fractions 1 to 5, with most of these forms in fractions 2 and 3. The proteolytically cleaved gp130(-/GCN4) glycoprotein, which is known to consist of monomeric gp120, sedimented in fractions 6 and 7. Likewise, the uncleaved forms of the gp140 (GCN4) and gp140 (CCG/GCN4) glycoproteins sedimented in fractions 1 to 4, whereas the cleaved forms of these glycoproteins sedimented in fractions 6 and/or 7. The vast majority of the gp140(-/GCN4) and gp140(-/CCG/GCN4) glycoproteins, which contain gp120-gp41 cleavage site modifications, sedimented in fractions 1 to 4. These results support the notion that the stability of higher-order forms of the soluble gp140 glycoproteins is enhanced by the GCN4 sequences and by alteration of the proteolytic cleavage site.

To obtain a more accurate estimate of the molecular weight of the higher order products, the gp120 and gp140(-/GCN4) glycoproteins were affinity purified and analyzed by molecular size exclusion chromatography. The proteins were highly pure, as determined by Coomassie blue staining of an SDS-polyacrylamide gel (Fig. 1E, left panel). The gp120 monomers were eluted at an apparent size of about 175 kDa, larger than the expected molecular weight but consistent with previously published results (5) (Fig. 1E, middle panel). The gp140(-/GCN4) proteins were eluted as one minor and two major peaks (Fig. 1E, right panel). The minor peak was eluted at a rate close to that of the gp120 monomers. The first major peak was eluted earlier than the largest molecular size marker (a 669-kDa protein) and is likely composed of higher-order aggregates. The second major peak was eluted at a rate expected for a 410-kDa protein, consistent with the molecular weight of a trimer.

The functional integrity of the gp120 subunits in the gp140 trimers was assessed by testing their ability to bind the natural ligands, CD4 and CCR5. As previously shown (50, 58), the HIV-1 YU2 gp120 glycoprotein bound CCR5 on a cell surface much more efficiently in the presence of soluble CD4 (sCD4) (Fig. 2). Similarly, the gp140(-/GCN4) glycoprotein bound CCR5 in a manner dependent on the presence of sCD4. The CCR5 binding was not as efficient for the gp140(-/GCN4) protein as for the gp120 monomer. Qualitatively, the gp120 subunits of the soluble gp140 trimer retained the ability to bind the CD4 receptor and undergo the structural changes necessary for subsequent CCR5 binding.


View larger version (40K):
[in this window]
[in a new window]
 
FIG. 2.   CCR5 binding of the soluble HIV-1 envelope glycoproteins. Equivalent amounts of radiolabeled soluble envelope glycoproteins were incubated with 10 µg of soluble CD4 per ml for 1 h at room temperature. The mixture was then applied to 106 Cf2ThsynCCR5 cells for 3 h at room temperature in the presence of 0.2% sodium azide. The cells were washed in cold Dulbecco's modified Eagle's medium. The cells were lysed, and the bound glycoproteins were detected by precipitation with 3 µl of pooled sera from HIV-1-infected individuals and 1 µg of C11 anti-gp120 antibody.

To examine whether soluble gp140 trimers could be created for another HIV-1 strain, the gp140(-/GCN4) glycoprotein was constructed using the envelope glycoproteins derived from the X4 virus HXBc2. The properties of the gp140(-/GCN4) glycoproteins of the YU2 and HXBc2 strains were indistinguishable on SDS-polyacrylamide gels and sucrose density gradients (data not shown). These results suggest that modification of the gp120-gp41 proteolytic cleavage site and addition of GCN4 trimeric sequences can be used to create stable trimers from several HIV-1 strains.

Several studies have suggested that HIV-1-neutralizing antibodies bind the oligomeric envelope glycoprotein complex more efficiently than nonneutralizing antibodies. To examine the relative exposure of neutralizing and nonneutralizing antibody epitopes on the soluble gp140 glycoproteins, the recognition of the YU2 gp140(-/GCN4) glycoprotein by a panel of anti-gp120 monoclonal antibodies was compared with the recognition of the gp120 and gp140(-) glycoproteins. The radiolabeled glycoproteins were precipitated by saturating amounts of either pooled sera from HIV-1-infected individuals or the monoclonal antibodies. The precipitation with pooled sera, which recognize a variety of HIV-1 envelope glycoprotein epitopes, controls for the relative amount of the three glycoproteins available for precipitation by antibodies (Fig. 3A, left panel). The monoclonal antibodies could be divided into three groups, based on their recognition of the gp140(-/GCN4) glycoprotein, relative to that of the gp120 and gp140(-) glycoproteins. The first group included neutralizing antibodies directed against the CD4 binding site (F105 and F91) or against CD4-induced epitopes (17b and 48d). These antibodies bound at least as well to the gp140(-/GCN4) glycoprotein as to the gp120 and gp140(-) glycoproteins (Fig. 3A, middle panel and data not shown). The second group included nonneutralizing antibodies (C11, A32, 522-149, M90, and #45). These antibodies bound the gp140(-/GCN4) glycoprotein at slightly reduced levels compared with the gp120 or gp140(-) glycoprotein (Fig. 3A, right panel and data not shown). The third group included antibodies (30D, 60D, and 522-149) directed against the extreme N and C termini of gp120. As had been previously observed for soluble gp130 glycoproteins, these antibodies recognized the gp140(-/GCN4) glycoprotein as efficiently as they did the gp120 glycoprotein (data not shown).


View larger version (47K):
[in this window]
[in a new window]
 
FIG. 3.   Recognition of the soluble HIV-1 envelope glycoprotein variants by anti-gp120 monoclonal antibodies. (A) Immunoprecipitation of the radiolabeled envelope glycoproteins was performed at room temperature with a mixture of sera from HIV-1-infected individuals (P.S.) or with monoclonal antibodies. The precipitates were analyzed on SDS-polyacrylamide gels under reducing conditions. The envelope glycoproteins were precipitated by a panel of anti-gp120 monoclonal antibodies that recognize discontinuous gp120 epitopes. The results shown are for the F105 antibody, which is directed against the CD4 binding site, and the C11 antibody, which is directed against a discontinuous epitope composed of elements of the first (C1) and fifth (C5) conserved regions of gp120. (B) Equivalent amounts of the radiolabeled YU2 gp120 glycoprotein and either the gp140(-) or the gp140(-/GCN4) glycoprotein were mixed and precipitated either with 3 µl of pooled sera from HIV-1-infected individuals or with the indicated monoclonal antibody (1 µg of antibody or 1 µl of ascites) at room temperature. The gp120 and gp140 glycoproteins were resolved on an SDS-polyacrylamide gel and quantitated by PhosphorImager (Molecular Dynamics) analysis. The ratio of gp140 to gp120 recognition for each antibody was divided by the gp140/gp120 ratio for the pooled sera to yield the relative affinity reported. The neutralizing antibodies used were F105 and F91, which are directed against the CD4 binding site, and 17b and 48d, which are directed against the CD4-induced epitopes. The nonneutralizing antibodies used were C11, A32, and 30D. A representative experiment from six experiments is shown. (C) The radiolabeled envelope glycoproteins were precipitated by a mixture of sera from HIV-1-infected individuals (P.S.) or by 1 µg of the 135/9 or M91 monoclonal antibodies. The precipitates were boiled in sample buffer containing 2% beta -ME and run on an SDS-polyacrylamide gel, followed by autoradiography. The leftmost panel was exposed to film overnight, whereas the other two panels were exposed to film for 6 days.

The above assays were conducted under conditions of high antibody concentration, which can obscure differences in affinity. To analyze the relative affinity of anti-gp120 antibodies more precisely, mixtures of equivalent amounts of the gp120 and gp140(-/GCN4) glycoproteins were precipitated either by pooled sera from HIV-1-infected individuals or by monoclonal antibodies. The 35S-methionine- and 35S-cysteine-labeled gp120 and gp140(-/GCN4) glycoproteins to be added to the mixture were first quantified by precipitations with an excess of pooled sera from HIV-1-infected individuals followed by PhosphorImager (Molecular Dynamics) analysis. Equivalent amounts of the two glycoproteins were mixed and precipitated at room temperature with either 3 µl of pooled HIV-1-positive sera, 1 µg of monoclonal antibody, or 1 µl of ascites in a total volume of 500 µl. The precipitated glycoproteins were run on an SDS-polyacrylamide gel, and the ratio of gp140(-/GCN4) to gp120 glycoprotein was calculated after PhosphorImager analysis. The relative affinity represents the gp140/gp120 ratio normalized to that obtained by precipitation with the pooled sera from HIV-1-infected individuals. Parallel studies were also conducted for the gp140(-) glycoprotein. Figure 3B shows that there were, at best, modest differences between neutralizing (F105, F91, 17b, and 48d) and nonneutralizing (C11, A32, and 30D) antibodies in their relative affinity for the gp140(-) glycoprotein. By contrast, the relative affinity of the neutralizing antibodies for the gp140(-/GCN4) glycoprotein was substantially higher than that of the nonneutralizing antibodies. These results suggest that, compared with the monomeric gp120 glycoprotein, the trimeric gp140(-/GCN4) glycoprotein exhibits some degree of occlusion or disruption of its nonneutralizing epitopes.

In our previous analysis of soluble gp130 trimers, some linear epitopes near the extreme N and C termini of gp120 were more accessible to monoclonal antibodies in the gp130 trimers than in gp120 monomers (60). This group of monoclonal antibodies includes 135/5 and 133/290, which are directed against linear sequences in the C1 region, and CRA-1 and M91, which recognize linear epitopes in the C5 region. These antibodies were tested for the ability to precipitate the soluble gp140 glycoproteins at saturating antibody concentrations (Fig. 3C). With similar amounts of input glycoproteins, as judged by precipitation by pooled sera from HIV-1-infected individuals (Fig. 3C, left panel), these monoclonal antibodies, including 135/9 (Fig. 3C, middle panel), M91 (Fig. 3C, right panel), 133/290, and CRA-1 (data not shown), preferentially precipitated gp140(-/GCN4) trimers compared with gp140(-) monomers. Of note, the efficiency of precipitation of the trimeric gp140(-/GCN4) and gp130(-/GCN4) glycoproteins by these antibodies was very low compared with that seen for the pooled HIV-1 positive sera (the left panel of Fig. 3C was exposed to film overnight, whereas the middle and right blots were exposed to film 6 days). Thus, although these antibodies exhibit preferential recognition of trimeric forms of the HIV-1 envelope glycoproteins, the absolute efficiency of this recognition is very low.

To explore the integrity and exposure of gp41 ectodomain epitopes in the soluble gp140 glycoproteins, a panel of monoclonal antibodies directed against linear and discontinuous epitopes in the gp41 ectodomain (16) was used to precipitate the YU2 gp140(-) and gp140(-/GCN4) glycoproteins (Fig. 4A). Compared with the pooled sera from HIV-1-infected individuals, the anti-gp41 monoclonal antibodies precipitated the gp140(-) and gp140(-/GCN4) glycoproteins inefficiently (the pooled serum precipitates were exposed to film overnight, whereas the others were exposed for 3 days). Nonetheless, the recognition of the gp140(-/GCN4) glycoprotein, relative to that of the gp140(-) glycoprotein, was equivalent for the T4 and D12 antibodies and significantly greater for the T3 and D50 antibodies. Although the specific nature of these epitopes remains to be characterized, the results do indicate that some previously defined gp41 ectodomain epitopes are present and exposed on at least a fraction of the gp140(-/GCN4) glycoprotein preparation. We also attempted to precipitate the gp140(-) and gp140(-/GCN4) glycoproteins with the 2F5 neutralizing anti-gp41 antibody. However, neither glycoprotein was efficiently recognized by the 2F5 antibody, probably due to the polymorphism in the gp41 epitope (ALDKWA instead of ELDKWA) in the YU2 strain.


View larger version (30K):
[in this window]
[in a new window]
 
FIG. 4.   Recognition of the soluble gp140 glycoproteins by ligands directed against gp41. (A) The radiolabeled gp140(-) and gp140(-/GCN4) glycoproteins were precipitated at room temperature either with a mixture of sera from HIV-1-infected individuals (P.S.) or with anti-gp41 monoclonal antibodies. The precipitates were boiled in sample buffer containing 2% beta -ME and run on an SDS-polyacrylamide gel, followed by autoradiography. The leftmost panel was exposed to film overnight, whereas the other panels were exposed to film for 3 days. (B) The radiolabeled envelope glycoproteins were mixed for 1 h at room temperature with a 50-fold molar excess of the PK-C299 peptide, which contains the DP178 sequence fused to a C9 epitope tag. Then 5 µg of the 1D4 antibody, which recognizes the C9 epitope tag, was used to precipitate the PK-C299-envelope glycoprotein complexes. The precipitates were boiled in sample buffer containing 2% beta -ME and analyzed on SDS-polyacrylamide gels. (C) The radiolabeled envelope glycoproteins were precipitated at room temperature either with a mixture of sera from HIV-1-infected individuals or with an excess of the NC-1 monoclonal antibody, which recognizes the HIV-1 gp41 six-helix bundle (30). The ratio of the envelope glycoprotein precipitated by the NC-1 antibody to that precipitated by the pooled sera is reported.

The formation of intersubunit disulfide bonds in the gp140(-/CCG/GCN4) glycoprotein (see above) suggested that some elements of the gp41 N36 coiled coil may be formed in the soluble gp140 trimers. We previously showed that the N36 coiled coil not only was formed in the soluble gp130 trimers but also was accessible to a peptide corresponding to the C34 region of gp41 (60). To examine this aspect of the soluble gp140 trimers, the recognition of the gp140(-), gp140(-/GCN4), and gp130(-/GCN4) glycoproteins by the C34-like peptide, DP178, was tested. For this purpose, we used the PK-C299 peptide which, in addition to the C34-like DP178 sequence, contains a C-terminal C9 tag that can be recognized by the 1D4 monoclonal antibody. Similar amounts of the radiolabeled glycoproteins were incubated with a 50-fold molar excess of the PK-C299 peptide and the 1D4 antibody. Figure 4B shows that only the gp130(-/GCN4) glycoprotein was efficiently precipitated by this procedure. These results indicate that the carboxy-terminal gp41 ectodomain sequences in the gp140(-/GCN4) glycoprotein either directly or indirectly limit the binding of the PK-C299 peptide-1D4 antibody complex to the soluble trimer.

To examine whether any of the soluble gp140 glycoproteins can generate six-helix bundles corresponding to the fusogenic conformation, the recognition of the glycoproteins by the NC-1 monoclonal antibody was examined. The NC-1 antibody was elicited by immunization with an HIV-1 six-helix bundle peptide complex and specifically recognizes the six-helix bundle structure (30). The Delta 528 glycoprotein was included as a positive control in these experiments. The Delta 528 glycoprotein contains a heterologous signal sequence from tissue plasminogen activator fused with residues 529 to 679 of the HIV-1 HXBc2 envelope glycoproteins. Thus, the Delta 528 glycoprotein represents a soluble form of the gp41 glycoprotein, including the N36 and C34 helices. A similar construct derived from the simian immunodeficiency virus envelope glycoproteins has been shown to form a six-helix bundle with high stability (61). The radiolabeled Delta 528, gp120, gp130(-/GCN4), and soluble gp140 glycoproteins were precipitated at room temperature by either the pooled sera from HIV-1-infected individuals or the NC-1 antibody. Figure 4C shows the percentage of the glycoproteins precipitated by the NC-1 antibody relative to the amounts precipitated by the pooled HIV-1-positive sera. More than 87% of the positive control Delta 528 glycoprotein recognized by the pooled sera was precipitated by the NC-1 antibody, as expected. The gp120 and gp140(-) monomers were not able to bind to the NC-1 monoclonal antibody, also as expected. The gp130(-/GCN4) glycoprotein was not detectably precipitated by the NC-1 antibody, consistent with the expectation that the absence of the C34 helices would preclude formation of the six-helix bundle. Approximately 16% of the gp140(-/GCN4) glycoprotein [labeled gp140Delta 675(-/GCN4) in Fig. 4C] recognized by the pooled sera was precipitated by the NC-1 antibody. This result indicates that at least a small fraction of the gp140(-/GCN4) glycoprotein assumes a fusogenic conformation that includes the gp41 six-helix bundle.

To examine whether the precise position of the trimeric GCN4 sequence influences the characteristics of the soluble gp140 glycoproteins, the original gp140(-/GCN4) construct, also designated gp140Delta 675(-/GCN4), was compared with two new constructs, gp140Delta 655(-/GCN4) and gp140Delta 683(-/GCN4). In the gp140Delta 655(-/GCN4) glycoprotein, the GCN4 sequences are placed carboxy terminal to residue 655, within the C34 sequence of gp41 (Fig. 5A). In the gp140Delta 683(-/GCN4) glycoprotein, the GCN4 sequences are placed carboxy terminal to residue 683, which is believed to represent the boundary of the gp41 ectodomain and the transmembrane region. Precipitates of these glycoproteins by pooled HIV-1-positive sera on a nonreducing SDS-polyacrylamide gel are shown in Fig. 5B. Higher-order forms consistent with dimers and trimers were evident for the gp140Delta 675(-/GCN4), gp140Delta 655(-/GCN4) and gp140Delta 683(-/GCN4) glycoproteins under these conditions. Unexpectedly, when the precipitates were boiled in sample buffer containing 2% beta -ME, the reduced gp140Delta 683(-/GCN4) monomers migrated similarly to the gp140(-) monomers and the reduced gp140Delta 675(-/GCN4) and gp140Delta 655(-/GCN4) monomers migrated faster than the gp140(-) monomers (Fig. 5C, left panel). When the precipitates were treated with a mixture of endoglycosidase F and N-glycosidase F, all four proteins migrated at their expected relative positions (Fig. 5C, right panel). These results indicate that the gp140(-) glycoprotein contains a higher proportion of N-linked carbohydrate than the other three glycoproteins. The gp140Delta 675(-/GCN4), gp140Delta 655(-/GCN4), and gp140Delta 683(-/GCN4) glycoproteins sedimented indistinguishably on sucrose density gradients (data not shown). The recognition of the gp140Delta 683(-/GCN4) glycoprotein by the NC-1 antibody was less than that of the gp140Delta 675(-/GCN4) glycoprotein (Fig. 4C), indicating a slightly decreased propensity for the former glycoprotein to form six-helix bundles. As expected from the disruption of the C34 helix, the gp140Delta 655(-/GCN4) glycoprotein was not precipitated by the NC-1 antibody (Fig. 4C).





View larger version (12182951K):
[in this window]
[in a new window]
 
FIG. 5.   Alteration of the position of the trimeric GCN4 sequence in the soluble gp140 constructs. (A) A detailed view of the carboxy-terminal portion of the HIV-1 gp41 ectodomain (YU2 sequence) is shown. The transmembrane (TM) and C34 helical regions are indicated. The boundaries between the gp41 sequences and the trimeric GCN4 sequence in the gp140Delta 655(-/GCN4), gp140Delta 675(-/GCN4), and gp140Delta 683(-/GCN4) constructs are indicated. In the gp140Delta 683(-/GCN4) construct, two glycine residues are present between lysine 683 and the trimeric GCN4 sequences. The position of the 2F5 epitope is also shown, although this epitope is altered in the YU2 strain. (B) Radiolabeled envelope glycoproteins were precipitated by a mixture of sera from HIV-1-infected individuals. Precipitates were run on an SDS-polyacrylamide gel under nonreducing conditions. Molecular size markers are shown at the left. (C) Radiolabeled envelope glycoproteins were precipitated by a mixture of sera from HIV-1-infected individuals. After three washes in PBS, the protein-bead complexes were suspended in 60 mM sodium acetate (pH 5.2), 25 mM EDTA, 0.2% SDS, 1% NP-40, and 1% beta -ME and heated to 100°C for 8 min. After cooling on ice, the samples were treated with 0.25 U each of endoglycosidase F and N-glycosidase F (Boehringer Mannheim) at 37°C for 1.5 h. The untreated controls and deglycosylated proteins were boiled in sample buffer containing 2% beta -ME and analyzed on an SDS-7.5% polyacrylamide gel. Molecular size markers are shown at the left. (D) The relative affinity, as defined for Fig. 3B, of the panel of monoclonal antibodies for the gp140Delta 683(-/GCN4) glycoprotein, compared with the YU2 gp120 glycoprotein, is shown. F105, F91, 17b, and 48d are neutralizing antibodies, whereas C11, A32, and 30D are nonneutralizing antibodies.

The recognition of the gp140Delta 675(-/GCN4), gp140Delta 655(-/GCN4), and gp140Delta 683(-/GCN4) glycoproteins by saturating concentrations of anti-gp120 and anti-gp41 antibodies was examined. No differences among the three glycoproteins were detected (data not shown). As was observed for the gp120Delta 675(-/GCN4) glycoprotein, the gp140Delta 655(-/GCN4) and gp140Delta 683(-/GCN4) glycoproteins were not efficiently precipitated by the PK-C299 peptide-1D4 antibody complex (data not shown).

The relative recognition of the soluble gp140 variants and the YU2 gp120 monomer by neutralizing and nonneutralizing antibodies was assessed in a direct competition assay similar to that used to generate the data shown in Fig. 3B. The relative affinities of antibodies for the gp140Delta 655(-/GCN4) glycoprotein were identical to those of antibodies for the gp140Delta 675(-/GCN4) glycoprotein (data not shown). Compared with the gp140Delta 675(-/GCN4) glycoprotein, the gp140Delta 683(-/GCN4) glycoprotein exhibited slight increases in the relative affinities of neutralizing antibodies and slight reductions in the relative affinities of some nonneutralizing antibodies (compare Fig. 5D with Fig. 3B). Although the significance of these small differences is unclear, the results indicate that the gp140(-/GCN4) variants exhibit only subtle conformational deviations from a common general structure.

Our previous work demonstrated that stable, soluble gp130 trimers of HIV-1 glycoproteins could be created by the addition of the trimeric GCN4 motif to the carboxyl terminus in combination with modification of the gp120-gp41 cleavage site (60). The introduction of cysteines in specific sites within the N36 region of these molecules resulted in the formation of intersubunit disulfide bonds that further stabilized the soluble gp130 trimers. In this study, similar approaches were applied to stabilize trimers containing the complete HIV-1 envelope glycoprotein ectodomains. In the context of the soluble gp140 glycoproteins, as was seen for the soluble gp130 constructs, the addition of carboxy-terminal GCN4 sequences and disruption of the gp120-gp41 cleavage site were necessary and sufficient for the production of relatively homogeneous trimers. When the wild-type cleavage site was present in the glycoprotein, only molecules that bypassed the proteolytic cleavage event remained oligomeric under the conditions employed in our assays. The stability of the gp140(-/GCN4) trimers is impressive; trimers were observed even after boiling in nonreducing buffers, SDS-polyacrylamide gel electrophoresis, and elution in high salt (3 M MgCl2) during immunoaffinity purification (Fig. 1B and E). The soluble gp140 trimers exhibited superior stability compared with the soluble gp130 trimers, suggesting the presence of additional intersubunit molecular contacts in the former glycoproteins. Based on previous mutagenic and structural studies of the gp41 glycoprotein (8, 61), the gp140 constructs, relative to the gp130 constructs, would also be expected to retain more of the regions important for interaction with the gp120 moieties in the oligomer.

It is likely that, in the absence of the GCN4 sequences, cleavage-defective gp140 glycoproteins can form oligomeric structures, especially when such proteins are produced at high concentrations favoring weak intermolecular interactions (16). Although gp140(-) glycoproteins produced in our system and analyzed under our conditions were mainly monomeric, we occasionally observed some stable dimer formation (shown, for example, in Fig. 5B). This is consistent with several studies that report the production of dimeric and tetrameric soluble, cleavage-defective HIV-1 envelope glycoproteins (16, 17). Thus, while the trimeric GCN4 sequences may not be required in all contexts for the formation of soluble envelope glycoprotein oligomers, they are apparently critical for the assembly and maintenance of relatively homogeneous trimers.

Several observations support the assertion that a major fraction of the gp140(-/GCN4) glycoprotein is indeed trimeric. First, by molecular size exclusion chromatography and, less accurately, by SDS-polyacrylamide gel electrophoresis, the oligomers exhibited an apparent molecular mass of 400 to 410 kDa, consistent with the presence of three gp140 subunits. Moreover, in velocity gradients, the gp140(-/GCN4) glycoprotein sedimented at rates similar to those of the gp130(-/GCN4) glycoprotein, which is documented to be trimeric (60). Second, the presence of the CCG substitution at positions 576 to 578 in the gp41 N36 sequence resulted in increased stability of the gp140(-/CCG/GCN4) oligomers compared with the gp140(-/GCN4) oligomers in the presence of a reducing agent (Fig. 1C). This observation is consistent with the formation of oligomer-stabilizing, intersubunit disulfide bonds, as has been previously seen for the HIV-1 gp160 envelope glycoprotein precursor and for soluble gp130 trimers (20, 60). Because the cysteine residues at positions 576 and 577 (at the d and e positions of a coiled-coil heptad repeat) are likely to form intersubunit disulfide bonds only in a trimeric context (20), the observed stability associated with the presence of these cysteines supports a trimeric model. Third, a detectable portion of some of the soluble gp140 oligomers was precipitated by the NC-1 antibody, which recognizes a six-helix bundle stabilized by the trimeric association of gp41 N36 helices. The NC-1 antibody recognized only the soluble gp140 glycoproteins [gp140Delta 675(-/GCN4) and gp140Delta 683(-/GCN4)] that both formed stable oligomers and contained intact N36 and C34 regions. Fourth, other antibodies, such as 135/9 and M91, which were previously shown to exhibit a strong preference for trimeric gp130 forms (60), also recognized the soluble gp140 oligomers. Finally, all of the above observations are consistent with the well-documented propensity of the modified GCN4 sequences used herein to form trimers (26). In the context of the fusion proteins studied here, the GCN4 sequences probably promote the weak trimeric interactions among the HIV-1 envelope glycoprotein components of the oligomeric complex.

The soluble gp140 trimers exhibited an exposure of gp120 and gp41 elements consistent with that expected for the functional HIV-1 envelope glycoprotein spike. Unlike the case for the gp130(-/GCN4) trimers (60), the hydrophobic groove on the N36 trimer is either not formed or not accessible on the soluble gp140 trimers. Thus, an antibody complexed to a C34-like peptide, DP178, can precipitate the gp130(-/GCN4) but not the gp140(-/GCN4) glycoprotein (Fig. 4B). It has been previously reported that the DP178 peptide cannot efficiently bind the native HIV-1 envelope glycoprotein complex prior to receptor binding (23). The soluble gp140 trimers also appear to assemble in a manner such that the receptor-binding regions and neutralizing antibody epitopes are exposed. By contrast, the gp120 epitopes for nonneutralizing antibodies are less available for binding than those on the monomeric gp120 glycoprotein. Nonneutralizing antibody epitopes on gp120 and gp41 are at least occasionally exposed on the soluble gp140 glycoproteins because high concentrations of these antibodies did precipitate these gp140 molecules. More work is required to determine how closely the soluble gp140 trimers resemble the biologically relevant virion envelope glycoprotein spike, which is an elusive entity due to the high ratio of defective to functional moieties in virus preparations (39, 44). The approaches described herein for stabilizing tractable, trimeric forms of the complete HIV-1 envelope glycoprotein ectodomains should assist efforts to understand the functional virion spike.


    ACKNOWLEDGMENTS

We thank S. Jiang and R. Doms for antibodies and P. Kolchinsky for assistance in one of the experiments. We also thank Y. McLaughlin and S. Farnum for assistance in manuscript preparation.

The work described here was supported by NIH grants AI24755, AI31783, and AI39420 to J.S. and NIH CFAR grant AI28691. We also acknowledge the support of the G. Harold and Leila Mathers Foundation, the Friends 10, Douglas and Judy Krupp, and the late William F. McCarty-Cooper.


    FOOTNOTES

* Corresponding author. Mailing address: Department of Cancer Immunology and AIDS, Dana-Farber Cancer Institute, 44 Binney St., JFB 824, Boston, MA 02115. Phone: (617) 632-3371. Fax: (617) 632-4338. E-mail: Joseph_Sodroski{at}dfci.harvard.edu.


    REFERENCES
Top
Abstract
Text
References

1. Alkhatib, G., C. Combadiere, C. C. Broder, Y. Feng, P. E. Kennedy, P. M. Murphy, and E. A. Berger. 1996. CC CKR5: a RANTES, MIP-1alpha , MIP-1beta receptor as a fusion cofactor for macrophage-tropic HIV-1. Science 272:1955-1958[Abstract].
2. Allan, J. S., J. E. Coligan, F. Barin, J. Sodroski, C. A. Rosen, W. A. Haseltine, T.-H. Lee, and M. Essex. 1985. Major glycoprotein antigens that induce antibodies in AIDS patients are encoded by HTLV-III. Science 228:1091-1094[Abstract/Free Full Text].
3. Barnett, S. W., S. Rajasekar, H. Legg, B. Doe, D. H. Fuller, J. R. Haynes, C. M. Walker, and K. S. Steimer. 1997. Vaccination with HIV-1 gp120 DNA induces immune responses that are boosted by a recombinant gp120 protein subunit. Vaccine 15:869-873[CrossRef][Medline].
4. Belshe, R. B., G. J. Gorse, M. J. Mulligan, T. G. Evans, M. C. Keefer, J.-L. Excler, A. M. Duliege, J. Tartaglia, W. I. Cox, J. McNamara, K.-L. Hwang, A. Bradney, D. C. Montefiori, and K. J. Weinhold. 1998. Induction of immune responses to HIV-1 by canarypox virus (ALVAC) HIV-1 and gp120 SF-2 recombinant vaccines in uninfected volunteers. AIDS 12:2407-2415[CrossRef][Medline].
5. Binley, J. M., R. W. Sanders, B. Clas, N. Schuelke, A. Master, Y. Guo, F. Kajumo, D. J. Anselma, P. J. Maddon, W. C. Olson, and J. P. Moore. 2000. A recombinant immunodeficiency virus type 1 envelope glycoprotein complex stabilized by an intermolecular disulfide bond between the gp120 and gp41 subunits is an antigenic mimic of the trimeric virion-associated structure. J. Virol. 74:627-643[Abstract/Free Full Text].
6. Broder, C. C., P. L. Earl, D. Long, S. T. Abedon, B. Moss, and R. W. Doms. 1994. Antigenic implications of human immunodeficiency virus type 1 envelope quaternary structure: oligomer-specific and -sensitive monoclonal antibodies. Proc. Natl. Acad. Sci. USA 91:11699-11703[Abstract/Free Full Text].
7. Burton, D. R., J. Pyati, R. Koduri, G. B. Thornton, L. S. W. Sawyer, R. M. Hendry, N. Dunlop, P. L. Nara, M. Lamacchia, E. Garratty, E. R. Stiehm, Y. J. Bryson, J. P. Moore, D. D. Ho, and C. F. Barbas, III. 1994. Efficient neutralization of primary isolates of HIV-1 by a recombinant monoclonal antibody. Science 266:1024-1027[Abstract/Free Full Text].
8. Cao, J., L. Bergeron, E. Helseth, M. Thali, H. Repke, and J. Sodroski. 1993. Effects of amino acid changes in the extracellular domain of the human immunodeficiency virus type 1 (HIV-1) gp41 envelope glycoprotein. J. Virol. 67:2747-2755[Abstract/Free Full Text].
9. Chan, D. C., D. Fass, J. M. Berger, and P. S. Kim. 1997. Core structure of gp41 from the HIV envelope glycoprotein. Cell 89:263-273[CrossRef][Medline].
10. Choe, H., M. Farzan, Y. Sun, N. Sullivan, B. Rollins, P. D. Ponath, L. Wu, C. R. Mackay, G. LaRosa, W. Newman, N. Gerard, C. Gerard, and J. Sodroski. 1996. The beta -chemokine receptors CCR3 and CCR5 facilitate infection by primary HIV-1 isolates. Cell 85:1135-1148[CrossRef][Medline].
11. Connor, R. I., B. T. Korber, B. S. Graham, B. H. Hahn, D. D. Ho, R. D. Walker, A. U. Neumann, S. H. Vermund, J. Mestecky, S. Jackson, E. Fenamore, Y. Cao, F. Gao, S. Kalam, K. J. Kunstman, D. McDonald, N. McWilliams, A. Trkola, J. P. Moore, and S. M. Wolinsky. 1998. Immunological and virological analyses of persons infected by human immunodeficiency virus type 1 while participating in trials of recombinant subunit vaccines. J. Virol. 72:1552-1576[Abstract/Free Full Text].
12. Dalgleish, A. G., P. C. Beverley, P. R. Clapham, D. H. Crawford, M. F. Greaves, and R. A. Weiss. 1984. The CD4 (T4) antigen is an essential component of the receptor for the AIDS retrovirus. Nature 312:763-767[CrossRef][Medline].
13. Deng, H., R. Liu, W. Ellmeier, S. Choe, D. Unutmaz, M. Burkhart, P. Di Marzio, S. Marmon, R. E. Sutton, C. M. Hill, C. B. Davis, S. C. Peiper, T. J. Schall, D. R. Littman, and N. R. Landau. 1996. Identification of a major co-receptor for primary isolates of HIV-1. Nature 381:661-666[CrossRef][Medline].
14. Doranz, B. J., J. Rucker, Y. Yi, R. J. Smyth, M. Samson, S. C. Peiper, M. Parmentier, R. G. Collman, and R. W. Doms. 1996. A dual-tropic primary HIV-1 isolate that uses fusin and the beta-chemokine receptors CKR-5, CKR-3, and CKR-2b as fusion cofactors. Cell 85:1149-1158[CrossRef][Medline].
15. Dragic, T., V. Litwin, G. P. Allaway, S. R. Martin, Y. Huang, K. A. Nagashima, C. Cayanan, P. J. Maddon, R. A. Koup, J. P. Moore, and W. A. Paxton. 1996. HIV-1 entry into CD4+ cells is mediated by the chemokine receptor CC-CKR-5. Nature 381:667-673[CrossRef][Medline].
16. Earl, P. L., C. C. Broder, D. Long, S. A. Lee, J. Peterson, S. Chakrabarti, R. W. Doms, and B. Moss. 1994. Native oligomeric human immunodeficiency virus type 1 envelope glycoprotein elicits diverse monoclonal antibody reactivities. J. Virol. 68:3015-3026[Abstract/Free Full Text].
17. Earl, P. L., R. W. Doms, and B. Moss. 1990. Oligomeric structure of the human immunodeficiency virus type 1 envelope glycoprotein. Proc. Natl. Acad. Sci. USA 87:648-652[Abstract/Free Full Text].
18. Earl, P. L., B. Moss, and R. W. Doms. 1991. Folding, interaction with GRP78-BiP, assembly, and transport of the human immunodeficiency virus type 1 envelope protein. J. Virol. 65:2047-2055[Abstract/Free Full Text].
19. Earl, P. L., and B. Moss. 1993. Mutational analysis of the assembly domain of the HIV-1 envelope glycoproteins. AIDS Res. Hum. Retrovir. 9:589-594[Medline].
20. Farzan, M., H. Choe, E. Desjardins, Y. Sun, J. Kuhn, J. Cao, D. Archambault, P. Kolchinsky, M. Koch, R. Wyatt, and J. Sodroski. 1998. Stabilization of human immunodeficiency virus type-1 envelope glycoprotein trimers by disulfide bonds introduced into the gp41 glycoprotein ectodomain. J. Virol. 72:7620-7625[Abstract/Free Full Text].
21. Feng, Y., C. C. Broder, P. E. Kennedy, and E. A. Berger. 1996. HIV-1 entry cofactor: functional cDNA cloning of a seven-transmembrane, G protein-coupled receptor. Science 272:872-877[Abstract].
22. Freed, E. O., D. J. Myers, and R. Risser. 1990. Characterization of the fusion domain of the human immunodeficiency virus type 1 envelope glycoprotein gp41. Proc. Natl. Acad. Sci. USA 87:4650-4654[Abstract/Free Full Text].
23. Furuta, R. A., C. T. Wild, Y. Weng, and C. D. Weiss. 1998. Capture of an early fusion-active conformation of HIV-1 gp41. Nat. Struct. Biol. 5:276-279[CrossRef][Medline].
24. Gelderblom, H. R., H. Reupke, and G. Pauli. 1985. Loss envelope antigens of HTLV-III/LAV, a factor in AIDS pathogenesis? Lancet ii:1016-1017.
25. Graham, B. S., M. J. McElrah, R. I. Conner, D. H. Schwartz, G. J. Gorse, M. C. Keefer, M. J. Mulligan, T. J. Mathews, S. W. Wolinsky, D. C. Montefiori, S. H. Vermund, J. S. Lambert, L. Corey, R. B. Belshe, R. Dolin, P. F. Wrightt, B. T. Korber, M. C. Wolff, and P. E. Fast. 1998. Analysis of intercurrent human immunodeficiency virus type 1 infections in phase I and II trials of current AIDS vaccines. J. Infect. Dis. 177:310-319[Medline].
26. Harbury, P. B., T. Zhang, P. S. Kim, and T. Alber. 1993. A switch between two-, three-, and four-stranded coiled coils in GCN4 leucine zipper mutants. Science 262:1401-1407[Abstract/Free Full Text].
27. Helseth, E., U. Olshevsky, C. Furman, and J. Sodroski. 1991. Human immunodeficiency virus type 1 gp120 envelope glycoprotein regions important for association with the gp41 transmembrane glycoprotein. J. Virol. 65:2119-2123[Abstract/Free Full Text].
28. Helseth, E., U. Olshevsky, D. Gabuzda, B. Ardman, W. A. Haseltine, and J. Sodroski. 1990. Changes in the transmembrane region of the human immunodeficiency virus type 1 gp41 envelope glycoprotein affect membrane fusion. J. Virol. 64:6314-6318[Abstract/Free Full Text].
29. Hill, C. P., D. Worthylale, D. P. Bancroft, A. M. Christensen, and W. I. Sundquist. 1996. Crystal structure of the trimeric human immunodeficiency virus type 1 matrix protein: implications for membrane association and assembly. Proc. Natl. Acad. Sci. USA 93:3099-3104[Abstract/Free Full Text].
30. Jiang, S., K. Lin, and M. Lu. 1998. A conformation-specific monoclonal antibody reacting with fusion-active gp41 from the human immunodeficiency virus type 1 envelope glycoprotein. J. Virol. 72:10213-10217[Abstract/Free Full Text].
31. Jiang, S., K. Lin, N. Strick, and A. R. Neurath. 1993. HIV-1 inhibition by a peptide. Nature 365:113[Medline].
32. Klatzmann, D., E. Chamoagne, S. Chamaret, J. Gruest, D. Guetard, T. Hercend, J. C. Gluckman, and L. Montagnier. 1984. T-lymphocyte T4 molecule behaves as the receptor for human retrovirus LAV. Nature 312:767-768[CrossRef][Medline].
33. Korber, B., F. Foley, C. Kuiken, S. Pillai, and J. Sodroski. 1998. Numbering positions in HIV relative to HXBc2. Human retroviruses and AIDS. Los Alamos National Laboratory, Los Alamos, N.Mex.
34. Kowalski, M., J. Potz, L. Basiripour, T. Dorfman, W. C. Goh, E. Terwilliger, A. Dayton, C. Rosen, W. Haseltine, and J. Sodroski. 1987. Functional regions of the envelope glycoprotein of human immunodeficiency virus type 1. Science 237:1351-1355[Abstract/Free Full Text].
35. Kwong, P. D., R. Wyatt, J. Robinson, R. W. Sweet, J. Sodroski, and W. A. Henderickson. 1998. Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody. Nature 393:648-659[CrossRef][Medline].
36. Lu, M., S. Blackow, and P. Kim. 1995. A trimeric structural domain of the HIV-1 transmembrane glycoprotein. Nat. Struct. Biol. 2:1075-1082[CrossRef][Medline].
37. Mascola, J. R., S. W. Snyder, O. S. Weislow, S. M. Belay, R. B. Belshe, D. H. Schwartz, M. L. Clements, R. Dolin, B. S. Graham, G. J. Gorse, M. C. Keefer, M. J. McElrath, M. C. Walker, K. F. Wagner, J. G. McNeil, F. E. McCutchan, and D. S. Burke. 1996. Immunization with envelope subunit vaccine products elicits neutralizing antibodies against laboratory-adapted but not primary isolates of human immunodeficiency virus type 1. The National Institute of Allergy and Infectious Diseases AIDS Vaccine Evaluation Group. J. Infect. Dis. 173:340-348[Medline].
38. McDougal, J. S., J. K. Nicholson, G. D. Cross, S. P. Cort, M. S. Kennedy, and A. C. Mawle. 1986. Binding of the human retrovirus HTLV-III/LAV/ARV/HIV to the CD4 (T4) molecule: conformation dependence, epitope mapping, antibody inhibition, and potential for idiotypic mimicry. J. Immunol. 137:2937-2944[Abstract].
39. McKeating, J. A., A. McKnight, and J. P. Moore. 1991. Differential loss of envelope glycoprotein gp120 from virions of human immunodeficiency virus type 1 isolates: effects on infectivity and neutralization. J. Virol. 65:852-860[Abstract/Free Full Text].
40. Moore, J. P., Y. Cao, L. Qing, Q. J. Sattentau, J. Pyati, R. Koduri, J. Robinson, C. F. Barbas III, D. R. Burton, and D. D. Ho. 1995. Primary isolates of human immunodeficiency virus type 1 are relatively resistant to neutralization by monoclonal antibodies to gp120, and their neutralization is not predicted by studies with monomeric gp120. J. Virol. 69:101-109[Abstract].
41. Moore, J. P., J. McKeating, Y. Huang, A. Ashkenazi, and D. D. Ho. 1992. Virions of primary human immunodeficiency virus type 1 isolates resistant to soluble CD4 (sCD4) neutralization differ in sCD4 binding and glycoprotein gp120 retention from sCD4-sensitive ones. J. Virol. 66:235-243[Abstract/Free Full Text].
42. Moore, J. P., and J. Sodroski. 1996. Antibody cross-competition analysis of the human immunodeficiency virus type 1 gp120 exterior envelope glycoprotein. J. Virol. 70:1863-1872[Abstract].
43. Muster, T., R. Guinea, A. Trkola, M. Purtscher, A. Klima, F. Steindl, P. Palese, and H. Katinger. 1994. Cross-neutralizing antibodies against divergent human immunodeficiency virus types isolates induced by the gp41 sequence ELDKWA. J. Virol. 68:4031-4034[Abstract/Free Full Text].
44. Parren, P. W., D. R. Burton, and Q. J. Sattentau. 1997. HIV-1 antibody---debris or virion? Nat. Med. 3:366-367[Medline].
45. Parren, P. W., I. Mondor, D. Naniche, H. J. Ditsel, P. J. Klasse, D. R. Burton, and Q. J. Sattentau. 1998. Neutralization of human immunodeficiency virus type 1 by antibody to gp120 is determined primarily by occupancy of sites on the virion irrespective of epitope specificity. J. Virol. 72:3512-3519[Abstract/Free Full Text].
46. Rao, Z., A. S. Belyaev, E. Fry, P. Roy, I. M. Jones, and D. I. Stuart. 1995. Crystal structure of SIV matrix antigen and implications for virus assembly. Nature 378:743-747[CrossRef][Medline].
47. Robey, W. G., B. Safai, S. Oroszlan, L. Q. Arthur, M. A. Gonda, R. C. Gallo, and P. J. Fischinger. 1985. Characterization of envelope and core gene products of HTLV-III with sera from AIDS patients. Science 228:593-595[Abstract/Free Full Text].
48. Tan, K., J.-H. Lee, J.-H. Wang, S. Shen, and M. Lu. 1997. Atomic structure of a thermostable subdomain of HIV-1 gp41. Proc. Natl. Acad. Sci. USA 94:12303-12308[Abstract/Free Full Text].
49. Thali, M., C. Furman, E. Helseth, H. Repke, and J. Sodroski. 1992. Lack of correlation between soluble CD4-induced shedding of the human immunodeficiency virus type 1 exterior envelope glycoprotein and subsequent membrane fusion events. J. Virol. 66:5516-5524[Abstract/Free Full Text].
50. Trkola, A., T. Dragic, J. Arthos, J. M. Binley, W. C. Olson, G. P. Allaway, C. Cheng-Mayer, J. Robinson, P. J. Maddon, and J. P. Moore. 1996. CD4-dependent, antibody-sensitive interactions between HIV-1 and its co-receptor CCR-5. Nature 384:184-187[CrossRef][Medline].
51. VanCott, T. C., J. R. Mascola, R. W. Kaminski, V. Kalyaraman, P. L. Hallberg, P. R. Burnett, J. T. Ulrich, D. J. Rechtman, and D. L. Birx. 1997. Antibodies with specificity to native gp120 and neutralization activity against primary human immunodeficiency virus type 1 isolates elicited by immunization with oligomeric gp160. J. Virol. 71:4319-4330[Abstract].
52. VanCott, T. C., J. R. Mascola, L. D. Loomis-Price, F. Sinangil, N. Zitomersky, J. McNeil, M. L. Robb, D. L. Birx, and S. Barnett. 1999. Cross-subtype neutralizing antibodies induced in baboons by a subtype E gp120 immunogen based on an R5 primary human immunodeficiency virus type 1 envelope. J. Virol. 73:4640-4650[Abstract/Free Full Text].
53. Veronese, F. D., A. L. DeVico, T. D. Copeland, S. Oroszlan, R. S. Gallo, and M. G. Sarngadharan. 1985. Characterization of gp41 as the transmembrane protein coded by the HTLV-III/LAV envelope gene. Science 229:1402-1405[Abstract/Free Full Text].
54. Weissenhorn, W., A. Dessen, S. C. Harrison, J. J. Skehel, and D. C. Wiley. 1997. Atomic structure of the ectodomain from HIV-1 gp41. Nature 387:426-430[CrossRef][Medline].
55. Wild, C. T., D. C. Shugars, T. K. Greenwell, C. B. McDanal, and T. J. Mathews. 1994. Peptides corresponding to a predictive alpha-helical domain of human immunodeficiency virus type 1 gp41 are potent inhibitors of virus infection. Proc. Natl. Acad. Sci. USA 91:9770-9774[Abstract/Free Full Text].
56. Willey, R. L., M. A. Martin, and K. W. Peden. 1994. Increase in soluble CD4 binding to and CD4-induced dissociation of gp120 from virions correlates with infectivity of human immunodeficiency virus type 1. J. Virol. 68:1029-1039[Abstract/Free Full Text].
57. Wrin, T., and J. H. Nunberg. 1994. HIV-1 MN recombinant gp120 vaccine serum, which fails to neutralize primary isolates of HIV-1, does not antagonize neutralization by antibodies from infected individuals. AIDS 8:1622-1623[CrossRef][Medline].
58. Wu, L., N. P. Gerard, R. Wyatt, H. Choe, C. Parolin, N. Ruffing, A. Borsetti, A. A. Cardoso, E. Desjardins, W. Newman, C. Gerard, and J. Sodroski. 1996. CD4-induced interaction of primary HIV-1 gp120 glycoproteins with the chemokine receptor CCR-5. Nature 384:179-183[CrossRef][Medline].
59. Wyatt, R., E. Desjardins, U. Olshevsky, C. Nixon, J. Binley, V. Olshevsky, and J. Sodroski. 1997. Analysis of the interaction of the human immunodeficiency virus type 1 gp120 envelope glycoprotein with the gp41 transmembrane glycoprotein. J. Virol. 71:9722-9731[Abstract].
60. Yang, X., L. Florin, M. Farzan, P. Kolchinsky, P. Kwong, J. Sodroski, and R. Wyatt. 2000. Modifications that stabilize human immunodeficiency virus envelope glycoprotein trimers in solution. J. Virol. 74:4746-4754[Abstract/Free Full Text].
61. Yang, Z. N., T. Mueser, J. Kaufman, S. Stahl, P. Wingfield, and C. C. Hyde. 1999. The crystal structure of the SIV gp41 ectodomain at 1.47 Å resolution. J. Struct. Biol. 126:131-144[CrossRef][Medline].


Journal of Virology, June 2000, p. 5716-5725, Vol. 74, No. 12
0022-538X/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.



This article has been cited by other articles:

  • Hatch, S. C., Archer, J., Gummuluru, S. (2009). Glycosphingolipid Composition of Human Immunodeficiency Virus Type 1 (HIV-1) Particles Is a Crucial Determinant for Dendritic Cell-Mediated HIV-1 trans-Infection. J. Virol. 83: 3496-3506 [Abstract] [Full Text]  
  • Morner, A., Douagi, I., Forsell, M. N. E., Sundling, C., Dosenovic, P., O'Dell, S., Dey, B., Kwong, P. D., Voss, G., Thorstensson, R., Mascola, J. R., Wyatt, R. T., Karlsson Hedestam, G. B. (2009). Human Immunodeficiency Virus Type 1 Env Trimer Immunization of Macaques and Impact of Priming with Viral Vector or Stabilized Core Protein. J. Virol. 83: 540-551 [Abstract] [Full Text]  
  • Doria-Rose, N. A., Klein, R. M., Manion, M. M., O'Dell, S., Phogat, A., Chakrabarti, B., Hallahan, C. W., Migueles, S. A., Wrammert, J., Ahmed, R., Nason, M., Wyatt, R. T., Mascola, J. R., Connors, M. (2009). Frequency and Phenotype of Human Immunodeficiency Virus Envelope-Specific B Cells from Patients with Broadly Cross-Neutralizing Antibodies. J. Virol. 83: 188-199 [Abstract] [Full Text]  
  • Chien, M.-P., Jiang, S., Chang, D.-K. (2008). The function of coreceptor as a basis for the kinetic dissection of HIV type 1 envelope protein-mediated cell fusion. FASEB J. 22: 1179-1192 [Abstract] [Full Text]  
  • Hernandez Alvarez, B., Hartmann, M. D., Albrecht, R., Lupas, A. N., Zeth, K., Linke, D. (2008). A new expression system for protein crystallization using trimeric coiled-coil adaptors. Protein Eng Des Sel 0: gzm071v2-8 [Abstract] [Full Text]  
  • Forsell, M. N. E., McInerney, G. M., Dosenovic, P., Hidmark, A. S., Eriksson, C., Liljestrom, P., Grundner, C., Karlsson Hedestam, G. B. (2007). Increased human immunodeficiency virus type 1 Env expression and antibody induction using an enhanced alphavirus vector. J. Gen. Virol. 88: 2774-2779 [Abstract] [Full Text]  
  • Bolesta, E., Kowalczyk, A., Wierzbicki, A., Eppolito, C., Kaneko, Y., Takiguchi, M., Stamatatos, L., Shrikant, P. A., Kozbor, D. (2006). Increased Level and Longevity of Protective Immune Responses Induced by DNA Vaccine Expressing the HIV-1 Env Glycoprotein when Combined with IL-21 and IL-15 Gene Delivery. J. Immunol. 177: 177-191 [Abstract] [Full Text]  
  • Selvarajah, S., Puffer, B., Pantophlet, R., Law, M., Doms, R. W., Burton, D. R. (2005). Comparing Antigenicity and Immunogenicity of Engineered gp120. J. Virol. 79: 12148-12163 [Abstract] [Full Text]  
  • Forsell, M. N. E., Li, Y., Sundback, M., Svehla, K., Liljestrom, P., Mascola, J. R., Wyatt, R., Hedestam, G. B. K. (2005). Biochemical and Immunogenic Characterization of Soluble Human Immunodeficiency Virus Type 1 Envelope Glycoprotein Trimers Expressed by Semliki Forest Virus. J. Virol. 79: 10902-10914 [Abstract] [Full Text]  
  • Li, M., Gao, F., Mascola, J. R., Stamatatos, L., Polonis, V. R., Koutsoukos, M., Voss, G., Goepfert, P., Gilbert, P., Greene, K. M., Bilska, M., Kothe, D. L., Salazar-Gonzalez, J. F., Wei, X., Decker, J. M., Hahn, B. H., Montefiori, D. C. (2005). Human Immunodeficiency Virus Type 1 env Clones from Acute and Early Subtype B Infections for Standardized Assessments of Vaccine-Elicited Neutralizing Antibodies. J. Virol. 79: 10108-10125 [Abstract] [Full Text]  
  • Poon, B., Hsu, J. F., Gudeman, V., Chen, I. S. Y., Grovit-Ferbas, K. (2005). Formaldehyde-Treated, Heat-Inactivated Virions with Increased Human Immunodeficiency Virus Type 1 Env Can Be Used To Induce High-Titer Neutralizing Antibody Responses. J. Virol. 79: 10210-10217 [Abstract] [Full Text]  
  • Pancera, M., Lebowitz, J., Schon, A., Zhu, P., Freire, E., Kwong, P. D., Roux, K. H., Sodroski, J., Wyatt, R. (2005). Soluble Mimetics of Human Immunodeficiency Virus Type 1 Viral Spikes Produced by Replacement of the Native Trimerization Domain with a Heterologous Trimerization Motif: Characterization and Ligand Binding Analysis. J. Virol. 79: 9954-9969 [Abstract] [Full Text]  
  • Bossart, K. N., Crameri, G., Dimitrov, A. S., Mungall, B. A., Feng, Y.-R., Patch, J. R., Choudhary, A., Wang, L.-F., Eaton, B. T., Broder, C. C. (2005). Receptor Binding, Fusion Inhibition, and Induction of Cross-Reactive Neutralizing Antibodies by a Soluble G Glycoprotein of Hendra Virus. J. Virol. 79: 6690-6702 [Abstract] [Full Text]  
  • Yang, X., Tomov, V., Kurteva, S., Wang, L., Ren, X., Gorny, M. K., Zolla-Pazner, S., Sodroski, J. (2004). Characterization of the Outer Domain of the gp120 Glycoprotein from Human Immunodeficiency Virus Type 1. J. Virol. 78: 12975-12986 [Abstract] [Full Text]  
  • Yuan, W., Craig, S., Si, Z., Farzan, M., Sodroski, J. (2004). CD4-Induced T-20 Binding to Human Immunodeficiency Virus Type 1 gp120 Blocks Interaction with the CXCR4 Coreceptor. J. Virol. 78: 5448-5457 [Abstract] [Full Text]  
  • Tripet, B., Howard, M. W., Jobling, M., Holmes, R. K., Holmes, K. V., Hodges, R. S. (2004). Structural Characterization of the SARS-Coronavirus Spike S Fusion Protein Core. J. Biol. Chem. 279: 20836-20849 [Abstract] [Full Text]  
  • Bower, J. F., Yang, X., Sodroski, J., Ross, T. M. (2004). Elicitation of Neutralizing Antibodies with DNA Vaccines Expressing Soluble Stabilized Human Immunodeficiency Virus Type 1 Envelope Glycoprotein Trimers Conjugated to C3d. J. Virol. 78: 4710-4719 [Abstract] [Full Text]  
  • York, J., Nunberg, J. H. (2004). Role of Hydrophobic Residues in the Central Ectodomain of gp41 in Maintaining the Association between Human Immunodeficiency Virus Type 1 Envelope Glycoprotein Subunits gp120 and gp41. J. Virol. 78: 4921-4926 [Abstract] [Full Text]  
  • Center, R. J., Lebowitz, J., Leapman, R. D., Moss, B. (2004). Promoting Trimerization of Soluble Human Immunodeficiency Virus Type 1 (HIV-1) Env through the Use of HIV-1/Simian Immunodeficiency Virus Chimeras. J. Virol. 78: 2265-2276 [Abstract] [Full Text]  
  • McKenna, P. M., Pomerantz, R. J., Dietzschold, B., McGettigan, J. P., Schnell, M. J. (2003). Covalently Linked Human Immunodeficiency Virus Type 1 gp120/gp41 Is Stably Anchored in Rhabdovirus Particles and Exposes Critical Neutralizing Epitopes. J. Virol. 77: 12782-12794 [Abstract] [Full Text]  
  • Srivastava, I. K., Stamatatos, L., Kan, E., Vajdy, M., Lian, Y., Hilt, S., Martin, L., Vita, C., Zhu, P., Roux, K. H., Vojtech, L., C. Montefiori, D., Donnelly, J., Ulmer, J. B., Barnett, S. W. (2003). Purification, Characterization, and Immunogenicity of a Soluble Trimeric Envelope Protein Containing a Partial Deletion of the V2 Loop Derived from SF162, an R5-Tropic Human Immunodeficiency Virus Type 1 Isolate. J. Virol. 77: 11244-11259 [Abstract] [Full Text]  
  • Pantophlet, R., Wilson, I. A., Burton, D. R. (2003). Hyperglycosylated Mutants of Human Immunodeficiency Virus (HIV) Type 1 Monomeric gp120 as Novel Antigens for HIV Vaccine Design. J. Virol. 77: 5889-5901 [Abstract] [Full Text]  
  • Sanders, R. W., Vesanen, M., Schuelke, N., Master, A., Schiffner, L., Kalyanaraman, R., Paluch, M., Berkhout, B., Maddon, P. J., Olson, W. C., Lu, M., Moore, J. P. (2002). Stabilization of the Soluble, Cleaved, Trimeric Form of the Envelope Glycoprotein Complex of Human Immunodeficiency Virus Type 1. J. Virol. 76: 8875-8889 [Abstract] [Full Text]  
  • He, Y., Honnen, W. J., Krachmarov, C. P., Burkhart, M., Kayman, S. C., Corvalan, J., Pinter, A. (2002). Efficient Isolation of Novel Human Monoclonal Antibodies with Neutralizing Activity Against HIV-1 from Transgenic Mice Expressing Human Ig Loci. J. Immunol. 169: 595-605 [Abstract] [Full Text]  
  • Schulke, N., Vesanen, M. S., Sanders, R. W., Zhu, P., Lu, M., Anselma, D. J., Villa, A. R., Parren, P. W. H. I., Binley, J. M., Roux, K. H., Maddon, P. J., Moore, J. P., Olson, W. C. (2002). Oligomeric and Conformational Properties of a Proteolytically Mature, Disulfide-Stabilized Human Immunodeficiency Virus Type 1 gp140 Envelope Glycoprotein. J. Virol. 76: 7760-7776 [Abstract] [Full Text]  
  • Chakrabarti, B. K., Kong, W.-p., Wu, B.-y., Yang, Z.-Y., Friborg, J., Ling, X., King, S. R., Montefiori, D. C., Nabel, G. J. (2002). Modifications of the Human Immunodeficiency Virus Envelope Glycoprotein Enhance Immunogenicity for Genetic Immunization. J. Virol. 76: 5357-5368 [Abstract] [Full Text]  
  • Liu, J., Wang, S., Hoxie, J. A., LaBranche, C. C., Lu, M. (2002). Mutations That Destabilize the gp41 Core Are Determinants for Stabilizing the Simian Immunodeficiency Virus-CPmac Envelope Glycoprotein Complex. J. Biol. Chem. 277: 12891-12900 [Abstract] [Full Text]  
  • Yang, X., Lee, J., Mahony, E. M., Kwong, P. D., Wyatt, R., Sodroski, J. (2002). Highly Stable Trimers Formed by Human Immunodeficiency Virus Type 1 Envelope Glycoproteins Fused with the Trimeric Motif of T4 Bacteriophage Fibritin. J. Virol. 76: 4634-4642 [Abstract] [Full Text]  
  • Grundner, C., Mirzabekov, T., Sodroski, J., Wyatt, R. (2002). Solid-Phase Proteoliposomes Containing Human Immunodeficiency Virus Envelope Glycoproteins. J. Virol. 76: 3511-3521 [Abstract] [Full Text]  
  • Binley, J. M., Sanders, R. W., Master, A., Cayanan, C. S., Wiley, C. L., Schiffner, L., Travis, B., Kuhmann, S., Burton, D. R., Hu, S.-L., Olson, W. C., Moore, J. P. (2002). Enhancing the Proteolytic Maturation of Human Immunodeficiency Virus Type 1 Envelope Glycoproteins. J. Virol. 76: 2606-2616 [Abstract] [Full Text]  
  • Srivastava, I. K., Stamatatos, L., Legg, H., Kan, E., Fong, A., Coates, S. R., Leung, L., Wininger, M., Donnelly, J. J., Ulmer, J. B., Barnett, S. W. (2002). Purification and Characterization of Oligomeric Envelope Glycoprotein from a Primary R5 Subtype B Human Immunodeficiency Virus. J. Virol. 76: 2835-2847 [Abstract] [Full Text]  
  • Kim, M., Chen, B., Hussey, R. E., Chishti, Y., Montefiori, D., Hoxie, J. A., Byron, O., Campbell, G., Harrison, S. C., Reinherz, E. L. (2001). The Stoichiometry of Trimeric SIV Glycoprotein Interaction with CD4 Differs from That of Anti-envelope Antibody Fab Fragments. J. Biol. Chem. 276: 42667-42676 [Abstract] [Full Text]  
  • Zhang, C. W-H., Chishti, Y., Hussey, R. E., Reinherz, E. L. (2001). Expression, Purification, and Characterization of Recombinant HIV gp140. THE gp41 ECTODOMAIN OF HIV OR SIMIAN IMMUNODEFICIENCY VIRUS IS SUFFICIENT TO MAINTAIN THE RETROVIRAL ENVELOPE GLYCOPROTEIN AS A TRIMER. J. Biol. Chem. 276: 39577-39585 [Abstract] [Full Text]  
  • Yang, X., Wyatt, R., Sodroski, J. (2001). Improved Elicitation of Neutralizing Antibodies against Primary Human Immunodeficiency Viruses by Soluble Stabilized Envelope Glycoprotein Trimers. J. Virol. 75: 1165-1171 [Abstract] [Full Text]  
  • Earl, P. L., Sugiura, W., Montefiori, D. C., Broder, C. C., Lee, S. A., Wild, C., Lifson, J., Moss, B. (2001). Immunogenicity and Protective Efficacy of Oligomeric Human Immunodeficiency Virus Type 1 gp140. J. Virol. 75: 645-653 [Abstract] [Full Text]  
  • Staropoli, I., Chanel, C., Girard, M., Altmeyer, R. (2000). Processing, Stability, and Receptor Binding Properties of Oligomeric Envelope Glycoprotein from a Primary HIV-1 Isolate. J. Biol. Chem. 275: 35137-35145 [Abstract] [Full Text]  

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Yang, X.
Right arrow Articles by Sodroski, J.