Previous Article | Next Article ![]()
Journal of Virology, June 2000, p. 5716-5725, Vol. 74, No. 12
Department of Cancer Immunology and AIDS,
Dana-Farber Cancer Institute,1
Department of Pathology2 and
Department of Medicine,3 Harvard Medical
School, and Department of Immunology and Infectious
Diseases, Harvard School of Public Health,4
Boston, Massachusetts 02115
Received 22 December 1999/Accepted 23 March 2000
The human immunodeficiency virus type 1 (HIV-1) envelope
glycoproteins function as a membrane-anchored trimer of
three gp120 exterior glycoproteins and three gp41
transmembrane glycoproteins. Previously, we reported three
approaches to stabilize soluble trimers containing parts of the gp41
ectodomains: addition of GCN4 trimeric helices,
disruption of the cleavage site between gp120 and gp41, and
introduction of cysteines in the gp41 coiled coil to form intersubunit
disulfide bonds. Here, we applied similar approaches to stabilize
soluble gp140 trimers including the complete gp120 and gp41
ectodomains. A combination of fusion with the GCN4 trimeric sequences and disruption of the gp120-gp41 cleavage
site resulted in relatively homogeneous gp140 trimers with exceptional stability. The gp120 epitopes recognized by neutralizing antibodies are
intact and exposed on these gp140 trimers. By contrast, the nonneutralizing antibody epitopes on the gp120 subunits of the soluble
trimers are relatively occluded compared with those on monomeric gp120
preparations. This antigenic similarity to the functional HIV-1
envelope glycoproteins and the presence of the complete
gp41 ectodomain should make the soluble gp140 trimers useful
tools for structural and immunologic studies.
The human immunodeficiency virus
type 1 (HIV-1) glycoproteins are initially synthesized as a
polyprotein precursor that undergoes posttranslational
modifications including glycosylation, oligomerization, and proteolytic
cleavage between the gp120 and gp41 subunits (2, 18, 47,
53). The mature envelope glycoproteins are
transported to the cell surface, where they are incorporated into the
virus as an oligomeric complex. The preponderance of evidence indicates that the mature oligomer consists of and functions as a trimer of
gp120-gp41 heterodimers (7, 20, 36, 46, 48, 54). The
envelope glycoprotein complex promotes viral entry into
host cells by binding cellular receptors and mediating the fusion of the viral and cellular membranes (1, 10, 12-15, 32, 38, 50). The gp120 exterior envelope glycoprotein binds
the CD4 molecule, which facilitates the interaction of gp120 with a
second receptor (typically, the chemokine receptor CCR5 or CXCR4). The interactions between gp120 and the cellular receptor molecules are
believed to trigger conformational changes in the envelope glycoprotein complex important for the membrane fusion
process. Mutagenic analyses and structural studies point to a pivotal
role of the gp41 ectodomain in the fusion process (8, 9,
22, 38, 48, 54). Two potential alpha-helical regions, designated N36 and C34, in the gp41 ectodomain have been shown to form a stable six-helix bundle (9, 48, 54). This bundle, which is
believed to represent the final, fusogenic conformation of gp41,
consists of three C34 helices packed into the hydrophobic grooves on
the outer surface of a trimeric N36 coiled coil. Because C34-like peptides can efficiently block HIV-1 envelope
glycoprotein-mediated membrane fusion, a gp41
conformational intermediate in which the grooves in the N36 coiled coil
are not occupied by C34 helices has been proposed (23, 31,
55). Of the several conformational states assumed by the HIV-1
envelope glycoproteins during the virus entry process,
detailed structural data are available only on a CD4-bound form of
gp120 and the gp41 six-helix bundle (9, 35, 48, 54).
Additional information on the other conformations, particularly
that associated with the virion trimer prior to receptor binding,
would be extremely valuable in guiding attempts at
pharmacologic and immunologic intervention.
Most antibodies elicited against the HIV-1 envelope
glycoproteins during natural infection or after vaccination
are incapable of neutralizing HIV-1 infectivity in vitro (6, 25,
37, 40, 45, 57). While several such antibodies effectively
neutralize viruses that are adapted to replicate in immortalized T-cell
lines, only three monoclonal antibodies, IgG1b12, 2G12, and 2F5,
neutralize a wide range of primary HIV-1 isolates (7, 43,
50). These three monoclonal antibodies exhibit a higher affinity
for oligomeric HIV-1 envelope glycoproteins on viruses or
cell surfaces than do most antibodies directed against the envelope
glycoproteins (44, 45). To date, most
recombinant HIV-1 glycoproteins tested as vaccine
candidates have been gp120 monomers. The antibody responses to gp120
are not usually effective in neutralizing primary HIV-1 isolates
(3, 4, 9, 25, 37, 52, 57). To attempt to mimic the native
HIV-1 envelope glycoprotein oligomer, soluble gp140
glycoproteins containing gp120 and the gp41
ectodomains have been created (6, 16, 17). When the
gp120-gp41 junction is modified to reduce proteolytic cleavage, these
soluble gp140 glycoproteins assemble into dimers and
tetramers in addition to the monomeric forms (6, 16, 17,
51). The elicitation of neutralizing antibodies by oligomeric
forms of soluble gp140 has been disappointing, perhaps because these
oligomers do not fully resemble the biologically relevant envelope
glycoprotein trimers (16, 51).
Attempts to produce HIV-1 envelope glycoprotein trimers for
structural and immunologic analysis have been frustrated by the lability of these glycoprotein complexes. Both the
intersubunit interactions that promote trimer formation and the
association between gp120 and gp41 are labile (24, 39).
Modifications of the gp120-gp41 cleavage site and introduction of
cysteine cross-links between gp120 and gp41 have been employed to
address the latter problem (5, 17). However, as alluded to
above, these approaches do not deal with the instability of the
oligomeric associations or with the tendency of the HIV-1 envelope
glycoprotein ectodomains to form dimers and
tetramers. Two strategies for stabilizing trimeric interactions
among HIV-1 envelope glycoprotein subunits have been devised (20, 60). The first strategy involves the
introduction of cysteine residues into the gp41 N36 coiled coil,
allowing the formation of disulfide bonds between the monomeric
subunits (20). This approach results in the cross-linking of
the membrane-anchored gp160 envelope glycoprotein precursor
only when the cysteines are positioned along the N36 coiled coil in
locations that allow disulfide bond formation in the context of a
trimer. These cysteines are not sufficient to stabilize soluble forms
of the HIV-1 envelope glycoproteins, probably because the
lability of the soluble trimer is such that disulfide bonds do not have
an opportunity to form (X. Yang, et al., unpublished data). The second
strategy is the addition of a trimeric GCN4 motif to the
carboxyl terminus of the soluble envelope glycoproteins
(26, 60). In initial studies, these helical GCN4 sequences
were added in register with the N36 helices, presumably extending the
trimeric gp41 coiled coil and thus enhancing the stability of
the trimer (60). Particularly when gp120-gp41 cleavage was
eliminated, these soluble gp130 glycoproteins containing
GCN4 sequences formed relatively stable and homogeneous trimers. In
these molecules, introduction of cysteines into appropriate locations
in the N36 coiled coil resulted in intersubunit disulfide bonds and
even greater stability of the trimers. Although these soluble gp130
trimers may be useful for some studies, they lack gp41
ectodomain structures that are thought to play a role in the
function and antigenicity of the HIV-1 envelope
glycoproteins. One example is the disulfide-linked loop at
positions 598 to 604 of gp41, which probably contributes to noncovalent
interactions with the first (C1) or fifth (C5) conserved region of the
gp120 glycoprotein (8, 27). A second example is
the heavily glycosylated gp41 region from residues 611 to 637. This
region is longer in the transmembrane envelope
glycoproteins of lentiviruses than it is in those of other
retroviruses, consistent with a potential role in immune evasion. A
third example is the gp41 C34 helix, which is an integral part of the
six-helix bundle thought to mediate virus-cell membrane fusion (9,
48, 54). Finally, the deleted regions in the soluble gp130
trimers encompass almost all of the major gp41 epitopes, including that
recognized by the 2F5 neutralizing antibody (16, 43).
In this study, we used combinations of the three approaches described
above (addition of trimeric GCN4 helices, modification of the
gp120-gp41 cleavage site, and introduction of cysteines into the gp41
N36 region) to create stable, soluble gp140 trimers containing most or
all of the gp41 ectodomain. Figure
1A shows the composition of the soluble
glycoproteins used in this study. In the nomenclature used
herein, "gp140" refers to an HIV-1 envelope glycoprotein (YU2 strain) truncated near the carboxyl
terminus of the gp41 ectodomain. A minus sign in the
parentheses after a construct name indicates the presence of
arginine-to-serine changes at residues 508 and 511, which impair
proteolytic cleavage between gp120 and gp41 sequences (60).
"CCG" in the parentheses indicates the substitution of two
cysteines and a glycine for residues 576 to 578, which
substitution has been shown to allow disulfide cross-linking of HIV-1
envelope glycoprotein trimers (20, 60).
"GCN4" in the parentheses indicates the addition of the
trimeric GCN4 sequence
(MKQIEDKIEEILSKIYHIENEIARIKKLIGEV) to the carboxyl
terminus of the glycoprotein.
0022-538X/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
Characterization of Stable, Soluble Trimers Containing Complete
Ectodomains of Human Immunodeficiency Virus Type 1 Envelope
Glycoproteins
![]()
ABSTRACT
Top
Abstract
Text
References
![]()
TEXT
Top
Abstract
Text
References

View larger version (47K):
[in a new window]
FIG. 1.
Characterization of the soluble gp140
envelope glycoproteins. (A) Soluble HIV-1 envelope
glycoprotein constructs. The expression plasmids were based
on the pSVIIIenv plasmid containing the env gene of the
HIV-1 YU2 strain. The plasmids expressing gp120, gp140(
) and
gp130(
/GCN4) have been described previously (60). The
gp140(
) glycoprotein is terminated after leucine 669 and
contains arginine-to-serine substitutions at positions 508 and 511 (SS), disrupting the proteolytic cleavage site between gp120 and gp41.
Previous studies indicated that the oligomerization of this gp140(
)
construct is similar to that of soluble glycoprotein
constructs containing the entire gp41 ectodomain
(19). The gp130(
/GCN4) glycoprotein contains
the same substitutions at the gp120-gp41 cleavage site and contains a
GCN4 trimeric motif carboxy terminal to leucine 580. The four
gp140 derivatives at the bottom of the panel have trimeric GCN4
sequences placed immediately after isoleucine 675. Some of these, in
addition, contain alterations of the gp120-gp41 cleavage site and/or
the CCG substitution at positions 576 to 578. The gp140 constructs were
made with the QuickChange kit (Stratagene), and the entire
env gene of the mutants was sequenced to verify the presence
of only the intended changes. The amino acid residues of the constructs
are numbered according to the prototypic HXBc2 sequence, in accordance
with the current convention (33). (B) Radiolabeled envelope
glycoproteins were precipitated for 3 h at room
temperature by an excess of pooled sera (3 µl) from HIV-1-infected
individuals and 10% (wt/vol) protein A-Sepharose beads (Pharmacia).
The beads were washed three times with phosphate-buffered saline (PBS),
boiled for 3 min in Laemmli sample buffer, and loaded onto an
SDS-7.5% polyacrylamide gel. The positions of monomeric and presumed
trimeric forms of several of the glycoproteins are
indicated. Mock, control cells transfected with an irrelevant plasmid.
Molecular size markers are shown at the left. (C) Radiolabeled envelope
glycoproteins were precipitated as described for panel B,
except that the precipitates were boiled for 3 min in Laemmli sample
buffer containing 2%
-ME. (D) Lanes 1 to 10, radiolabeled envelope
glycoproteins analyzed on 10 to 25% sucrose density
gradients, with fraction 1 collected from the bottom of the gradient
and fraction 10 collected from the top of the gradient. Fractions were
precipitated by a mixture of sera from HIV-1-infected individuals.
Precipitates were analyzed on SDS-polyacrylamide gels under reducing
conditions. (E) The YU2 gp120 and gp140(
/GCN4)
glycoproteins were purified from transfected 293T cell
supernatants by an F105 antibody affinity column. The
glycoproteins were eluted in 3 M MgCl2 and then
dialyzed against 100 volumes of PBS. The purified
glycoproteins were run on an SDS-polyacrylamide gel and
then stained with Coomassie blue (left panel). Approximately 10 µg of
the purified glycoproteins was then analyzed on a Superdex
200 column and compared with molecular weight standards, the positions
of which are indicated by arrows. Elution times are also shown. The
aggregate peak for the gp140(
/GCN4) glycoprotein elutes
before the largest molecular size standard used (669 kDa).
To examine the expression and properties of these soluble gp140
glycoproteins, transfected 293T cells transiently
expressing these proteins were radiolabeled with
35S-methionine and 35S-cysteine. The cell
supernatants were precipitated with 3 µl of pooled sera from
HIV-1-infected individuals, and the precipitated proteins were resolved
on a sodium dodecyl sulfate (SDS)-7.5% polyacrylamide gel after
boiling for 3 min in 1× Laemmli sample buffer. As shown in Fig. 1B,
the gp120 and gp140(
) glycoproteins migrated on the gel
mainly as monomers. A small amount of dimeric gp140(
)
glycoprotein was visible under these conditions. The addition of the trimeric GCN4 sequences resulted in the
production of high-molecular-weight forms of the soluble gp140
glycoproteins that remained stable even after boiling and
electrophoresis. These higher-order species migrated with an apparent
molecular mass of approximately 400 kDa, based on extrapolation from
the migration of the molecular weight markers and the apparent dimeric
forms of the glycoproteins. Under identical conditions, the
soluble gp130(
/GCN4) glycoprotein migrated primarily as a
monomer, indicating that the soluble gp140 oligomers are more stable
than the previously described soluble gp130 trimers (60).
The soluble gp140 glycoproteins with a proteolytic cleavage
site modification [gp140(
/GCN4) and gp140(
/CCG/GCN4)]
exhibited few or no monomeric forms on the gel. The gp140(GCN4) and
gp140(CCG/GCN4) glycoproteins, which contain an intact
gp120-gp41 proteolytic cleavage site, were resolved into both
oligomeric and monomeric forms. Significantly, the monomeric forms of
the gp140(GCN4) and gp140(CCG/GCN4) glycoproteins
migrated comparably to gp120, not gp140. This result suggests
that the proteolytically cleaved soluble gp140 oligomers are less
stable than the uncleaved forms of the same glycoprotein.
Consistent with this interpretation, when the oligomeric forms of
gp140(GCN4) and gp140(CCG/GCN4) glycoproteins
were disrupted by being heated to 100°C for 8 min in sample
buffer containing 5%
-mercaptoethanol (
-ME), they migrated
alongside the gp140(
) glycoprotein (data not shown).
Thus, as was previously observed for soluble gp130 trimers
(60), elimination of gp120-gp41 cleavage contributes to the
stability of the soluble oligomer.
To investigate whether intersubunit disulfide bonds formed in the
gp140(
/CCG/GCN4) glycoprotein, compared with the
negative and positive control glycoproteins
[gp140(
/GCN4) and gp130(
/CCG/GCN4), respectively],
the proteins were analyzed after boiling in sample buffer
containing 2%
-ME. Under these reducing conditions, both the
oligomeric gp140(
/CCG/GCN4) and gp130(
/CCG/GCN4)
glycoproteins were more stable than the
gp140(
/GCN4) oligomers (Fig. 1C). This result is consistent with
the formation of intersubunit disulfide bonds in at least some of the
gp140(
/CCG/GCN4) glycoproteins.
To analyze the soluble gp140 glycoproteins under conditions
more gentle than those described above, the radiolabeled
glycoproteins were concentrated and resolved by velocity
centrifugation in 10 ml of 10 to 25% continuous sucrose gradients. Ten
fractions were collected from each gradient, and the envelope
glycoproteins in each fraction were detected by
precipitation by pooled sera from HIV-1-infected individuals. The
precipitates were analyzed on reducing SDS-polyacrylamide gels. As
shown in Fig. 1D, the gp140(
) glycoprotein sedimented
in fractions 4 to 8, with the majority of the protein in fractions 6 and 7. The uncleaved portion of the gp130(
/GCN4)
glycoprotein, which has been shown to be trimeric and was included as a positive control, sedimented in fractions 1 to 5, with most of these forms in fractions 2 and 3. The proteolytically cleaved gp130(
/GCN4) glycoprotein, which is known to
consist of monomeric gp120, sedimented in fractions 6 and 7. Likewise, the uncleaved forms of the gp140 (GCN4) and gp140 (CCG/GCN4)
glycoproteins sedimented in fractions 1 to 4, whereas
the cleaved forms of these glycoproteins sedimented in
fractions 6 and/or 7. The vast majority of the gp140(
/GCN4) and
gp140(
/CCG/GCN4) glycoproteins, which contain
gp120-gp41 cleavage site modifications, sedimented in fractions 1 to 4. These results support the notion that the stability of higher-order
forms of the soluble gp140 glycoproteins is enhanced by the
GCN4 sequences and by alteration of the proteolytic cleavage site.
To obtain a more accurate estimate of the molecular weight of the
higher order products, the gp120 and gp140(
/GCN4)
glycoproteins were affinity purified and analyzed by
molecular size exclusion chromatography. The proteins were highly pure,
as determined by Coomassie blue staining of an SDS-polyacrylamide gel
(Fig. 1E, left panel). The gp120 monomers were eluted at an apparent
size of about 175 kDa, larger than the expected molecular weight but consistent with previously published results (5) (Fig. 1E, middle panel). The gp140(
/GCN4) proteins were eluted as one minor and two major peaks (Fig. 1E, right panel). The minor peak was eluted
at a rate close to that of the gp120 monomers. The first major peak was
eluted earlier than the largest molecular size marker (a 669-kDa
protein) and is likely composed of higher-order aggregates. The second
major peak was eluted at a rate expected for a 410-kDa protein,
consistent with the molecular weight of a trimer.
The functional integrity of the gp120 subunits in the gp140 trimers was
assessed by testing their ability to bind the natural ligands, CD4 and
CCR5. As previously shown (50, 58), the HIV-1 YU2 gp120
glycoprotein bound CCR5 on a cell surface much more efficiently in the presence of soluble CD4 (sCD4) (Fig.
2). Similarly, the gp140(
/GCN4)
glycoprotein bound CCR5 in a manner dependent on the
presence of sCD4. The CCR5 binding was not as efficient for the
gp140(
/GCN4) protein as for the gp120 monomer. Qualitatively, the
gp120 subunits of the soluble gp140 trimer retained the ability to bind
the CD4 receptor and undergo the structural changes necessary for
subsequent CCR5 binding.
|
To examine whether soluble gp140 trimers could be created for another
HIV-1 strain, the gp140(
/GCN4) glycoprotein was
constructed using the envelope glycoproteins derived from
the X4 virus HXBc2. The properties of the gp140(
/GCN4)
glycoproteins of the YU2 and HXBc2 strains were
indistinguishable on SDS-polyacrylamide gels and sucrose density
gradients (data not shown). These results suggest that modification of
the gp120-gp41 proteolytic cleavage site and addition of GCN4
trimeric sequences can be used to create stable trimers from
several HIV-1 strains.
Several studies have suggested that HIV-1-neutralizing antibodies bind
the oligomeric envelope glycoprotein complex more
efficiently than nonneutralizing antibodies. To examine the relative
exposure of neutralizing and nonneutralizing antibody epitopes on the
soluble gp140 glycoproteins, the recognition of the YU2
gp140(
/GCN4) glycoprotein by a panel of anti-gp120
monoclonal antibodies was compared with the recognition of the gp120
and gp140(
) glycoproteins. The radiolabeled
glycoproteins were precipitated by saturating amounts of
either pooled sera from HIV-1-infected individuals or the monoclonal
antibodies. The precipitation with pooled sera, which recognize a
variety of HIV-1 envelope glycoprotein epitopes, controls
for the relative amount of the three glycoproteins
available for precipitation by antibodies (Fig.
3A, left panel). The monoclonal antibodies could be divided into three groups, based on their recognition of the gp140(
/GCN4) glycoprotein,
relative to that of the gp120 and gp140(
)
glycoproteins. The first group included neutralizing
antibodies directed against the CD4 binding site (F105 and F91) or
against CD4-induced epitopes (17b and 48d). These antibodies bound at
least as well to the gp140(
/GCN4) glycoprotein as to
the gp120 and gp140(
) glycoproteins (Fig. 3A, middle
panel and data not shown). The second group included nonneutralizing antibodies (C11, A32, 522-149, M90, and #45). These antibodies bound
the gp140(
/GCN4) glycoprotein at slightly reduced
levels compared with the gp120 or gp140(
)
glycoprotein (Fig. 3A, right panel and data not shown). The
third group included antibodies (30D, 60D, and 522-149) directed
against the extreme N and C termini of gp120. As had been previously
observed for soluble gp130 glycoproteins, these antibodies
recognized the gp140(
/GCN4) glycoprotein as efficiently as they did the gp120 glycoprotein (data not
shown).
|
The above assays were conducted under conditions of high antibody
concentration, which can obscure differences in affinity. To analyze
the relative affinity of anti-gp120 antibodies more precisely, mixtures
of equivalent amounts of the gp120 and gp140(
/GCN4) glycoproteins were precipitated either by pooled sera from
HIV-1-infected individuals or by monoclonal antibodies. The
35S-methionine- and 35S-cysteine-labeled gp120
and gp140(
/GCN4) glycoproteins to be added to the
mixture were first quantified by precipitations with an excess of
pooled sera from HIV-1-infected individuals followed by
PhosphorImager (Molecular Dynamics) analysis. Equivalent
amounts of the two glycoproteins were mixed and
precipitated at room temperature with either 3 µl of pooled
HIV-1-positive sera, 1 µg of monoclonal antibody, or 1 µl of
ascites in a total volume of 500 µl. The precipitated
glycoproteins were run on an SDS-polyacrylamide gel, and
the ratio of gp140(
/GCN4) to gp120 glycoprotein was
calculated after PhosphorImager analysis. The relative affinity
represents the gp140/gp120 ratio normalized to that obtained by
precipitation with the pooled sera from HIV-1-infected individuals.
Parallel studies were also conducted for the gp140(
)
glycoprotein. Figure 3B shows that there were, at
best, modest differences between neutralizing (F105, F91, 17b, and 48d)
and nonneutralizing (C11, A32, and 30D) antibodies in their relative
affinity for the gp140(
) glycoprotein. By contrast,
the relative affinity of the neutralizing antibodies for the
gp140(
/GCN4) glycoprotein was substantially higher
than that of the nonneutralizing antibodies. These results suggest
that, compared with the monomeric gp120 glycoprotein, the
trimeric gp140(
/GCN4) glycoprotein exhibits
some degree of occlusion or disruption of its nonneutralizing epitopes.
In our previous analysis of soluble gp130 trimers, some linear epitopes
near the extreme N and C termini of gp120 were more accessible to
monoclonal antibodies in the gp130 trimers than in gp120 monomers
(60). This group of monoclonal antibodies includes 135/5 and
133/290, which are directed against linear sequences in the C1 region,
and CRA-1 and M91, which recognize linear epitopes in the C5 region.
These antibodies were tested for the ability to precipitate the soluble
gp140 glycoproteins at saturating antibody concentrations
(Fig. 3C). With similar amounts of input glycoproteins, as
judged by precipitation by pooled sera from HIV-1-infected
individuals (Fig. 3C, left panel), these monoclonal antibodies,
including 135/9 (Fig. 3C, middle panel), M91 (Fig. 3C, right panel),
133/290, and CRA-1 (data not shown), preferentially precipitated
gp140(
/GCN4) trimers compared with gp140(
) monomers.
Of note, the efficiency of precipitation of the trimeric
gp140(
/GCN4) and gp130(
/GCN4) glycoproteins by
these antibodies was very low compared with that seen for the pooled
HIV-1 positive sera (the left panel of Fig. 3C was exposed to film
overnight, whereas the middle and right blots were exposed to film
6 days). Thus, although these antibodies exhibit preferential recognition of trimeric forms of the HIV-1 envelope
glycoproteins, the absolute efficiency of this recognition
is very low.
To explore the integrity and exposure of gp41 ectodomain
epitopes in the soluble gp140 glycoproteins, a panel of
monoclonal antibodies directed against linear and discontinuous
epitopes in the gp41 ectodomain (16) was used to
precipitate the YU2 gp140(
) and gp140(
/GCN4)
glycoproteins (Fig. 4A).
Compared with the pooled sera from HIV-1-infected individuals, the
anti-gp41 monoclonal antibodies precipitated the gp140(
) and
gp140(
/GCN4) glycoproteins inefficiently (the pooled
serum precipitates were exposed to film overnight, whereas the
others were exposed for 3 days). Nonetheless, the recognition of the
gp140(
/GCN4) glycoprotein, relative to that of the
gp140(
) glycoprotein, was equivalent for the T4 and
D12 antibodies and significantly greater for the T3 and D50 antibodies.
Although the specific nature of these epitopes remains to be
characterized, the results do indicate that some previously defined
gp41 ectodomain epitopes are present and exposed on
at least a fraction of the gp140(
/GCN4) glycoprotein
preparation. We also attempted to precipitate the gp140(
) and
gp140(
/GCN4) glycoproteins with the 2F5
neutralizing anti-gp41 antibody. However, neither
glycoprotein was efficiently recognized by the 2F5
antibody, probably due to the polymorphism in the gp41 epitope
(ALDKWA instead of ELDKWA) in the YU2 strain.
|
The formation of intersubunit disulfide bonds in the
gp140(
/CCG/GCN4) glycoprotein (see above) suggested
that some elements of the gp41 N36 coiled coil may be formed in the
soluble gp140 trimers. We previously showed that the N36 coiled coil
not only was formed in the soluble gp130 trimers but also was
accessible to a peptide corresponding to the C34 region of gp41
(60). To examine this aspect of the soluble gp140 trimers,
the recognition of the gp140(
), gp140(
/GCN4), and
gp130(
/GCN4) glycoproteins by the C34-like peptide,
DP178, was tested. For this purpose, we used the PK-C299 peptide which,
in addition to the C34-like DP178 sequence, contains a C-terminal C9
tag that can be recognized by the 1D4 monoclonal antibody. Similar
amounts of the radiolabeled glycoproteins were incubated
with a 50-fold molar excess of the PK-C299 peptide and the 1D4
antibody. Figure 4B shows that only the gp130(
/GCN4)
glycoprotein was efficiently precipitated by this
procedure. These results indicate that the carboxy-terminal gp41
ectodomain sequences in the gp140(
/GCN4)
glycoprotein either directly or indirectly limit the
binding of the PK-C299 peptide-1D4 antibody complex to the soluble trimer.
To examine whether any of the soluble gp140 glycoproteins
can generate six-helix bundles corresponding to the fusogenic
conformation, the recognition of the glycoproteins by the
NC-1 monoclonal antibody was examined. The NC-1 antibody was elicited
by immunization with an HIV-1 six-helix bundle peptide complex and
specifically recognizes the six-helix bundle structure (30).
The
528 glycoprotein was included as a positive control
in these experiments. The
528 glycoprotein contains a
heterologous signal sequence from tissue plasminogen activator fused
with residues 529 to 679 of the HIV-1 HXBc2 envelope
glycoproteins. Thus, the
528 glycoprotein
represents a soluble form of the gp41 glycoprotein,
including the N36 and C34 helices. A similar construct derived from the
simian immunodeficiency virus envelope glycoproteins has
been shown to form a six-helix bundle with high stability
(61). The radiolabeled
528, gp120, gp130(
/GCN4),
and soluble gp140 glycoproteins were precipitated at room
temperature by either the pooled sera from HIV-1-infected individuals
or the NC-1 antibody. Figure 4C shows the percentage of the
glycoproteins precipitated by the NC-1 antibody relative to
the amounts precipitated by the pooled HIV-1-positive sera. More than
87% of the positive control
528 glycoprotein recognized by the pooled sera was precipitated by the NC-1 antibody, as expected. The gp120 and gp140(
) monomers were not able to bind to the NC-1 monoclonal antibody, also as expected. The gp130(
/GCN4)
glycoprotein was not detectably precipitated by the NC-1
antibody, consistent with the expectation that the absence of the C34
helices would preclude formation of the six-helix bundle. Approximately
16% of the gp140(
/GCN4) glycoprotein [labeled
gp140
675(
/GCN4) in Fig. 4C] recognized by the pooled sera was
precipitated by the NC-1 antibody. This result indicates that at least
a small fraction of the gp140(
/GCN4) glycoprotein
assumes a fusogenic conformation that includes the gp41 six-helix bundle.
To examine whether the precise position of the trimeric GCN4
sequence influences the characteristics of the soluble gp140 glycoproteins, the original gp140(
/GCN4) construct,
also designated gp140
675(
/GCN4), was compared with two
new constructs, gp140
655(
/GCN4) and gp140
683(
/GCN4). In
the gp140
655(
/GCN4) glycoprotein, the GCN4 sequences
are placed carboxy terminal to residue 655, within the C34 sequence of
gp41 (Fig. 5A). In the
gp140
683(
/GCN4) glycoprotein, the GCN4 sequences are
placed carboxy terminal to residue 683, which is believed to represent
the boundary of the gp41 ectodomain and the transmembrane
region. Precipitates of these glycoproteins by pooled
HIV-1-positive sera on a nonreducing SDS-polyacrylamide gel are shown
in Fig. 5B. Higher-order forms consistent with dimers and
trimers were evident for the gp140
675(
/GCN4), gp140
655(
/GCN4)
and gp140
683(
/GCN4) glycoproteins under these conditions. Unexpectedly, when the precipitates were boiled in sample
buffer containing 2%
-ME, the reduced gp140
683(
/GCN4) monomers
migrated similarly to the gp140(
) monomers and the reduced gp140
675(
/GCN4) and gp140
655(
/GCN4) monomers migrated faster than the gp140(
) monomers (Fig. 5C, left panel). When the
precipitates were treated with a mixture of endoglycosidase F and
N-glycosidase F, all four proteins migrated at their
expected relative positions (Fig. 5C, right panel). These results
indicate that the gp140(
) glycoprotein contains a
higher proportion of N-linked carbohydrate than the
other three glycoproteins. The gp140
675(
/GCN4),
gp140
655(
/GCN4), and gp140
683(
/GCN4)
glycoproteins sedimented indistinguishably on sucrose
density gradients (data not shown). The recognition of the
gp140
683(
/GCN4) glycoprotein by the NC-1 antibody
was less than that of the gp140
675(
/GCN4)
glycoprotein (Fig. 4C), indicating a slightly decreased
propensity for the former glycoprotein to form six-helix
bundles. As expected from the disruption of the C34 helix, the
gp140
655(
/GCN4) glycoprotein was not precipitated by the NC-1 antibody (Fig. 4C).
|
The recognition of the gp140
675(
/GCN4),
gp140
655(
/GCN4), and gp140
683(
/GCN4)
glycoproteins by saturating concentrations of anti-gp120
and anti-gp41 antibodies was examined. No differences among the three
glycoproteins were detected (data not shown). As was
observed for the gp120
675(
/GCN4) glycoprotein, the
gp140
655(
/GCN4) and gp140
683(
/GCN4)
glycoproteins were not efficiently precipitated by the
PK-C299 peptide-1D4 antibody complex (data not shown).
The relative recognition of the soluble gp140 variants and the YU2
gp120 monomer by neutralizing and nonneutralizing antibodies was
assessed in a direct competition assay similar to that used to generate
the data shown in Fig. 3B. The relative affinities of antibodies for
the gp140
655(
/GCN4) glycoprotein were identical to
those of antibodies for the gp140
675(
/GCN4)
glycoprotein (data not shown). Compared with the
gp140
675(
/GCN4) glycoprotein, the
gp140
683(
/GCN4) glycoprotein exhibited slight
increases in the relative affinities of neutralizing antibodies and
slight reductions in the relative affinities of some nonneutralizing antibodies (compare Fig. 5D with Fig. 3B). Although the significance of
these small differences is unclear, the results indicate that the
gp140(
/GCN4) variants exhibit only subtle conformational deviations from a common general structure.
Our previous work demonstrated that stable, soluble gp130 trimers of
HIV-1 glycoproteins could be created by the addition of the
trimeric GCN4 motif to the carboxyl terminus in combination with modification of the gp120-gp41 cleavage site (60). The introduction of cysteines in specific sites within the N36 region of
these molecules resulted in the formation of intersubunit disulfide bonds that further stabilized the soluble gp130 trimers. In this study,
similar approaches were applied to stabilize trimers containing the
complete HIV-1 envelope glycoprotein ectodomains.
In the context of the soluble gp140 glycoproteins, as was
seen for the soluble gp130 constructs, the addition of carboxy-terminal
GCN4 sequences and disruption of the gp120-gp41 cleavage site were
necessary and sufficient for the production of relatively homogeneous
trimers. When the wild-type cleavage site was present in the
glycoprotein, only molecules that bypassed the proteolytic
cleavage event remained oligomeric under the conditions employed in our
assays. The stability of the gp140(
/GCN4) trimers is impressive;
trimers were observed even after boiling in nonreducing buffers,
SDS-polyacrylamide gel electrophoresis, and elution in high salt (3 M
MgCl2) during immunoaffinity purification (Fig. 1B and E).
The soluble gp140 trimers exhibited superior stability compared with
the soluble gp130 trimers, suggesting the presence of additional
intersubunit molecular contacts in the former
glycoproteins. Based on previous mutagenic and structural
studies of the gp41 glycoprotein (8, 61), the
gp140 constructs, relative to the gp130 constructs, would also be
expected to retain more of the regions important for interaction with
the gp120 moieties in the oligomer.
It is likely that, in the absence of the GCN4 sequences,
cleavage-defective gp140 glycoproteins can form oligomeric
structures, especially when such proteins are produced at high
concentrations favoring weak intermolecular interactions
(16). Although gp140(
) glycoproteins
produced in our system and analyzed under our conditions were mainly
monomeric, we occasionally observed some stable dimer formation (shown,
for example, in Fig. 5B). This is consistent with several studies that
report the production of dimeric and tetrameric soluble,
cleavage-defective HIV-1 envelope glycoproteins (16,
17). Thus, while the trimeric GCN4 sequences may not be
required in all contexts for the formation of soluble envelope glycoprotein oligomers, they are apparently critical for
the assembly and maintenance of relatively homogeneous trimers.
Several observations support the assertion that a major fraction of the
gp140(
/GCN4) glycoprotein is indeed trimeric.
First, by molecular size exclusion chromatography and, less accurately, by SDS-polyacrylamide gel electrophoresis, the oligomers exhibited an
apparent molecular mass of 400 to 410 kDa, consistent with the presence
of three gp140 subunits. Moreover, in velocity gradients, the
gp140(
/GCN4) glycoprotein sedimented at rates similar
to those of the gp130(
/GCN4) glycoprotein, which is
documented to be trimeric (60). Second, the presence
of the CCG substitution at positions 576 to 578 in the gp41 N36
sequence resulted in increased stability of the gp140(
/CCG/GCN4)
oligomers compared with the gp140(
/GCN4) oligomers in the
presence of a reducing agent (Fig. 1C). This observation is consistent
with the formation of oligomer-stabilizing, intersubunit disulfide
bonds, as has been previously seen for the HIV-1 gp160 envelope
glycoprotein precursor and for soluble gp130 trimers
(20, 60). Because the cysteine residues at positions 576 and
577 (at the d and e positions of a coiled-coil heptad repeat) are
likely to form intersubunit disulfide bonds only in a trimeric
context (20), the observed stability associated with the
presence of these cysteines supports a trimeric model. Third, a
detectable portion of some of the soluble gp140 oligomers was precipitated by the NC-1 antibody, which recognizes a six-helix bundle
stabilized by the trimeric association of gp41 N36 helices. The
NC-1 antibody recognized only the soluble gp140
glycoproteins [gp140
675(
/GCN4) and
gp140
683(
/GCN4)] that both formed stable oligomers and
contained intact N36 and C34 regions. Fourth, other antibodies, such as
135/9 and M91, which were previously shown to exhibit a strong
preference for trimeric gp130 forms (60), also
recognized the soluble gp140 oligomers. Finally, all of the above
observations are consistent with the well-documented propensity of the
modified GCN4 sequences used herein to form trimers (26). In
the context of the fusion proteins studied here, the GCN4 sequences probably promote the weak trimeric interactions among the HIV-1 envelope glycoprotein components of the oligomeric complex.
The soluble gp140 trimers exhibited an exposure of gp120 and gp41
elements consistent with that expected for the functional HIV-1
envelope glycoprotein spike. Unlike the case for the
gp130(
/GCN4) trimers (60), the hydrophobic groove on
the N36 trimer is either not formed or not accessible on the soluble
gp140 trimers. Thus, an antibody complexed to a C34-like peptide,
DP178, can precipitate the gp130(
/GCN4) but not the
gp140(
/GCN4) glycoprotein (Fig. 4B). It has been
previously reported that the DP178 peptide cannot efficiently bind the
native HIV-1 envelope glycoprotein complex prior to
receptor binding (23). The soluble gp140 trimers also appear
to assemble in a manner such that the receptor-binding regions and
neutralizing antibody epitopes are exposed. By contrast, the gp120
epitopes for nonneutralizing antibodies are less available for
binding than those on the monomeric gp120 glycoprotein.
Nonneutralizing antibody epitopes on gp120 and gp41 are at least
occasionally exposed on the soluble gp140 glycoproteins
because high concentrations of these antibodies did precipitate these
gp140 molecules. More work is required to determine how closely the
soluble gp140 trimers resemble the biologically relevant virion
envelope glycoprotein spike, which is an elusive entity due
to the high ratio of defective to functional moieties in virus
preparations (39, 44). The approaches described herein for
stabilizing tractable, trimeric forms of the complete HIV-1
envelope glycoprotein ectodomains should assist
efforts to understand the functional virion spike.
| |
ACKNOWLEDGMENTS |
|---|
We thank S. Jiang and R. Doms for antibodies and P. Kolchinsky for assistance in one of the experiments. We also thank Y. McLaughlin and S. Farnum for assistance in manuscript preparation.
The work described here was supported by NIH grants AI24755, AI31783, and AI39420 to J.S. and NIH CFAR grant AI28691. We also acknowledge the support of the G. Harold and Leila Mathers Foundation, the Friends 10, Douglas and Judy Krupp, and the late William F. McCarty-Cooper.
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: Department of Cancer Immunology and AIDS, Dana-Farber Cancer Institute, 44 Binney St., JFB 824, Boston, MA 02115. Phone: (617) 632-3371. Fax: (617) 632-4338. E-mail: Joseph_Sodroski{at}dfci.harvard.edu.
| |
REFERENCES |
|---|
|
|
|---|
| 1. |
Alkhatib, G.,
C. Combadiere,
C. C. Broder,
Y. Feng,
P. E. Kennedy,
P. M. Murphy, and E. A. Berger.
1996.
CC CKR5: a RANTES, MIP-1 , MIP-1 receptor as a fusion cofactor for macrophage-tropic HIV-1.
Science
272:1955-1958[Abstract].
|
| 2. |
Allan, J. S.,
J. E. Coligan,
F. Barin,
J. Sodroski,
C. A. Rosen,
W. A. Haseltine,
T.-H. Lee, and M. Essex.
1985.
Major glycoprotein antigens that induce antibodies in AIDS patients are encoded by HTLV-III.
Science
228:1091-1094 |
| 3. | Barnett, S. W., S. Rajasekar, H. Legg, B. Doe, D. H. Fuller, J. R. Haynes, C. M. Walker, and K. S. Steimer. 1997. Vaccination with HIV-1 gp120 DNA induces immune responses that are boosted by a recombinant gp120 protein subunit. Vaccine 15:869-873[CrossRef][Medline]. |
| 4. | Belshe, R. B., G. J. Gorse, M. J. Mulligan, T. G. Evans, M. C. Keefer, J.-L. Excler, A. M. Duliege, J. Tartaglia, W. I. Cox, J. McNamara, K.-L. Hwang, A. Bradney, D. C. Montefiori, and K. J. Weinhold. 1998. Induction of immune responses to HIV-1 by canarypox virus (ALVAC) HIV-1 and gp120 SF-2 recombinant vaccines in uninfected volunteers. AIDS 12:2407-2415[CrossRef][Medline]. |
| 5. |
Binley, J. M.,
R. W. Sanders,
B. Clas,
N. Schuelke,
A. Master,
Y. Guo,
F. Kajumo,
D. J. Anselma,
P. J. Maddon,
W. C. Olson, and J. P. Moore.
2000.
A recombinant immunodeficiency virus type 1 envelope glycoprotein complex stabilized by an intermolecular disulfide bond between the gp120 and gp41 subunits is an antigenic mimic of the trimeric virion-associated structure.
J. Virol.
74:627-643 |
| 6. |
Broder, C. C.,
P. L. Earl,
D. Long,
S. T. Abedon,
B. Moss, and R. W. Doms.
1994.
Antigenic implications of human immunodeficiency virus type 1 envelope quaternary structure: oligomer-specific and -sensitive monoclonal antibodies.
Proc. Natl. Acad. Sci. USA
91:11699-11703 |
| 7. |
Burton, D. R.,
J. Pyati,
R. Koduri,
G. B. Thornton,
L. S. W. Sawyer,
R. M. Hendry,
N. Dunlop,
P. L. Nara,
M. Lamacchia,
E. Garratty,
E. R. Stiehm,
Y. J. Bryson,
J. P. Moore,
D. D. Ho, and C. F. Barbas, III.
1994.
Efficient neutralization of primary isolates of HIV-1 by a recombinant monoclonal antibody.
Science
266:1024-1027 |
| 8. |
Cao, J.,
L. Bergeron,
E. Helseth,
M. Thali,
H. Repke, and J. Sodroski.
1993.
Effects of amino acid changes in the extracellular domain of the human immunodeficiency virus type 1 (HIV-1) gp41 envelope glycoprotein.
J. Virol.
67:2747-2755 |
| 9. | Chan, D. C., D. Fass, J. M. Berger, and P. S. Kim. 1997. Core structure of gp41 from the HIV envelope glycoprotein. Cell 89:263-273[CrossRef][Medline]. |
| 10. |
Choe, H.,
M. Farzan,
Y. Sun,
N. Sullivan,
B. Rollins,
P. D. Ponath,
L. Wu,
C. R. Mackay,
G. LaRosa,
W. Newman,
N. Gerard,
C. Gerard, and J. Sodroski.
1996.
The -chemokine receptors CCR3 and CCR5 facilitate infection by primary HIV-1 isolates.
Cell
85:1135-1148[CrossRef][Medline].
|
| 11. |
Connor, R. I.,
B. T. Korber,
B. S. Graham,
B. H. Hahn,
D. D. Ho,
R. D. Walker,
A. U. Neumann,
S. H. Vermund,
J. Mestecky,
S. Jackson,
E. Fenamore,
Y. Cao,
F. Gao,
S. Kalam,
K. J. Kunstman,
D. McDonald,
N. McWilliams,
A. Trkola,
J. P. Moore, and S. M. Wolinsky.
1998.
Immunological and virological analyses of persons infected by human immunodeficiency virus type 1 while participating in trials of recombinant subunit vaccines.
J. Virol.
72:1552-1576 |
| 12. | Dalgleish, A. G., P. C. Beverley, P. R. Clapham, D. H. Crawford, M. F. Greaves, and R. A. Weiss. 1984. The CD4 (T4) antigen is an essential component of the receptor for the AIDS retrovirus. Nature 312:763-767[CrossRef][Medline]. |
| 13. | Deng, H., R. Liu, W. Ellmeier, S. Choe, D. Unutmaz, M. Burkhart, P. Di Marzio, S. Marmon, R. E. Sutton, C. M. Hill, C. B. Davis, S. C. Peiper, T. J. Schall, D. R. Littman, and N. R. Landau. 1996. Identification of a major co-receptor for primary isolates of HIV-1. Nature 381:661-666[CrossRef][Medline]. |
| 14. | Doranz, B. J., J. Rucker, Y. Yi, R. J. Smyth, M. Samson, S. C. Peiper, M. Parmentier, R. G. Collman, and R. W. Doms. 1996. A dual-tropic primary HIV-1 isolate that uses fusin and the beta-chemokine receptors CKR-5, CKR-3, and CKR-2b as fusion cofactors. Cell 85:1149-1158[CrossRef][Medline]. |
| 15. | Dragic, T., V. Litwin, G. P. Allaway, S. R. Martin, Y. Huang, K. A. Nagashima, C. Cayanan, P. J. Maddon, R. A. Koup, J. P. Moore, and W. A. Paxton. 1996. HIV-1 entry into CD4+ cells is mediated by the chemokine receptor CC-CKR-5. Nature 381:667-673[CrossRef][Medline]. |
| 16. |
Earl, P. L.,
C. C. Broder,
D. Long,
S. A. Lee,
J. Peterson,
S. Chakrabarti,
R. W. Doms, and B. Moss.
1994.
Native oligomeric human immunodeficiency virus type 1 envelope glycoprotein elicits diverse monoclonal antibody reactivities.
J. Virol.
68:3015-3026 |
| 17. |
Earl, P. L.,
R. W. Doms, and B. Moss.
1990.
Oligomeric structure of the human immunodeficiency virus type 1 envelope glycoprotein.
Proc. Natl. Acad. Sci. USA
87:648-652 |
| 18. |
Earl, P. L.,
B. Moss, and R. W. Doms.
1991.
Folding, interaction with GRP78-BiP, assembly, and transport of the human immunodeficiency virus type 1 envelope protein.
J. Virol.
65:2047-2055 |
| 19. | Earl, P. L., and B. Moss. 1993. Mutational analysis of the assembly domain of the HIV-1 envelope glycoproteins. AIDS Res. Hum. Retrovir. 9:589-594[Medline]. |
| 20. |
Farzan, M.,
H. Choe,
E. Desjardins,
Y. Sun,
J. Kuhn,
J. Cao,
D. Archambault,
P. Kolchinsky,
M. Koch,
R. Wyatt, and J. Sodroski.
1998.
Stabilization of human immunodeficiency virus type-1 envelope glycoprotein trimers by disulfide bonds introduced into the gp41 glycoprotein ectodomain.
J. Virol.
72:7620-7625 |
| 21. | Feng, Y., C. C. Broder, P. E. Kennedy, and E. A. Berger. 1996. HIV-1 entry cofactor: functional cDNA cloning of a seven-transmembrane, G protein-coupled receptor. Science 272:872-877[Abstract]. |
| 22. |
Freed, E. O.,
D. J. Myers, and R. Risser.
1990.
Characterization of the fusion domain of the human immunodeficiency virus type 1 envelope glycoprotein gp41.
Proc. Natl. Acad. Sci. USA
87:4650-4654 |
| 23. | Furuta, R. A., C. T. Wild, Y. Weng, and C. D. Weiss. 1998. Capture of an early fusion-active conformation of HIV-1 gp41. Nat. Struct. Biol. 5:276-279[CrossRef][Medline]. |
| 24. | Gelderblom, H. R., H. Reupke, and G. Pauli. 1985. Loss envelope antigens of HTLV-III/LAV, a factor in AIDS pathogenesis? Lancet ii:1016-1017. |
| 25. | Graham, B. S., M. J. McElrah, R. I. Conner, D. H. Schwartz, G. J. Gorse, M. C. Keefer, M. J. Mulligan, T. J. Mathews, S. W. Wolinsky, D. C. Montefiori, S. H. Vermund, J. S. Lambert, L. Corey, R. B. Belshe, R. Dolin, P. F. Wrightt, B. T. Korber, M. C. Wolff, and P. E. Fast. 1998. Analysis of intercurrent human immunodeficiency virus type 1 infections in phase I and II trials of current AIDS vaccines. J. Infect. Dis. 177:310-319[Medline]. |
| 26. |
Harbury, P. B.,
T. Zhang,
P. S. Kim, and T. Alber.
1993.
A switch between two-, three-, and four-stranded coiled coils in GCN4 leucine zipper mutants.
Science
262:1401-1407 |
| 27. |
Helseth, E.,
U. Olshevsky,
C. Furman, and J. Sodroski.
1991.
Human immunodeficiency virus type 1 gp120 envelope glycoprotein regions important for association with the gp41 transmembrane glycoprotein.
J. Virol.
65:2119-2123 |
| 28. |
Helseth, E.,
U. Olshevsky,
D. Gabuzda,
B. Ardman,
W. A. Haseltine, and J. Sodroski.
1990.
Changes in the transmembrane region of the human immunodeficiency virus type 1 gp41 envelope glycoprotein affect membrane fusion.
J. Virol.
64:6314-6318 |
| 29. |
Hill, C. P.,
D. Worthylale,
D. P. Bancroft,
A. M. Christensen, and W. I. Sundquist.
1996.
Crystal structure of the trimeric human immunodeficiency virus type 1 matrix protein: implications for membrane association and assembly.
Proc. Natl. Acad. Sci. USA
93:3099-3104 |
| 30. |
Jiang, S.,
K. Lin, and M. Lu.
1998.
A conformation-specific monoclonal antibody reacting with fusion-active gp41 from the human immunodeficiency virus type 1 envelope glycoprotein.
J. Virol.
72:10213-10217 |
| 31. | Jiang, S., K. Lin, N. Strick, and A. R. Neurath. 1993. HIV-1 inhibition by a peptide. Nature 365:113[Medline]. |
| 32. | Klatzmann, D., E. Chamoagne, S. Chamaret, J. Gruest, D. Guetard, T. Hercend, J. C. Gluckman, and L. Montagnier. 1984. T-lymphocyte T4 molecule behaves as the receptor for human retrovirus LAV. Nature 312:767-768[CrossRef][Medline]. |
| 33. | Korber, B., F. Foley, C. Kuiken, S. Pillai, and J. Sodroski. 1998. Numbering positions in HIV relative to HXBc2. Human retroviruses and AIDS. Los Alamos National Laboratory, Los Alamos, N.Mex. |
| 34. |
Kowalski, M.,
J. Potz,
L. Basiripour,
T. Dorfman,
W. C. Goh,
E. Terwilliger,
A. Dayton,
C. Rosen,
W. Haseltine, and J. Sodroski.
1987.
Functional regions of the envelope glycoprotein of human immunodeficiency virus type 1.
Science
237:1351-1355 |
| 35. | Kwong, P. D., R. Wyatt, J. Robinson, R. W. Sweet, J. Sodroski, and W. A. Henderickson. 1998. Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody. Nature 393:648-659[CrossRef][Medline]. |
| 36. | Lu, M., S. Blackow, and P. Kim. 1995. A trimeric structural domain of the HIV-1 transmembrane glycoprotein. Nat. Struct. Biol. 2:1075-1082[CrossRef][Medline]. |
| 37. | Mascola, J. R., S. W. Snyder, O. S. Weislow, S. M. Belay, R. B. Belshe, D. H. Schwartz, M. L. Clements, R. Dolin, B. S. Graham, G. J. Gorse, M. C. Keefer, M. J. McElrath, M. C. Walker, K. F. Wagner, J. G. McNeil, F. E. McCutchan, and D. S. Burke. 1996. Immunization with envelope subunit vaccine products elicits neutralizing antibodies against laboratory-adapted but not primary isolates of human immunodeficiency virus type 1. The National Institute of Allergy and Infectious Diseases AIDS Vaccine Evaluation Group. J. Infect. Dis. 173:340-348[Medline]. |
| 38. | McDougal, J. S., J. K. Nicholson, G. D. Cross, S. P. Cort, M. S. Kennedy, and A. C. Mawle. 1986. Binding of the human retrovirus HTLV-III/LAV/ARV/HIV to the CD4 (T4) molecule: conformation dependence, epitope mapping, antibody inhibition, and potential for idiotypic mimicry. J. Immunol. 137:2937-2944[Abstract]. |
| 39. |
McKeating, J. A.,
A. McKnight, and J. P. Moore.
1991.
Differential loss of envelope glycoprotein gp120 from virions of human immunodeficiency virus type 1 isolates: effects on infectivity and neutralization.
J. Virol.
65:852-860 |
| 40. | Moore, J. P., Y. Cao, L. Qing, Q. J. Sattentau, J. Pyati, R. Koduri, J. Robinson, C. F. Barbas III, D. R. Burton, and D. D. Ho. 1995. Primary isolates of human immunodeficiency virus type 1 are relatively resistant to neutralization by monoclonal antibodies to gp120, and their neutralization is not predicted by studies with monomeric gp120. J. Virol. 69:101-109[Abstract]. |
| 41. |
Moore, J. P.,
J. McKeating,
Y. Huang,
A. Ashkenazi, and D. D. Ho.
1992.
Virions of primary human immunodeficiency virus type 1 isolates resistant to soluble CD4 (sCD4) neutralization differ in sCD4 binding and glycoprotein gp120 retention from sCD4-sensitive ones.
J. Virol.
66:235-243 |
| 42. | Moore, J. P., and J. Sodroski. 1996. Antibody cross-competition analysis of the human immunodeficiency virus type 1 gp120 exterior envelope glycoprotein. J. Virol. 70:1863-1872[Abstract]. |
| 43. |
Muster, T.,
R. Guinea,
A. Trkola,
M. Purtscher,
A. Klima,
F. Steindl,
P. Palese, and H. Katinger.
1994.
Cross-neutralizing antibodies against divergent human immunodeficiency virus types isolates induced by the gp41 sequence ELDKWA.
J. Virol.
68:4031-4034 |
| 44. |
Parren, P. W.,
D. R. Burton, and Q. J. Sattentau.
1997.
HIV-1 antibody debris or virion?
Nat. Med.
3:366-367[Medline].
|
| 45. |
Parren, P. W.,
I. Mondor,
D. Naniche,
H. J. Ditsel,
P. J. Klasse,
D. R. Burton, and Q. J. Sattentau.
1998.
Neutralization of human immunodeficiency virus type 1 by antibody to gp120 is determined primarily by occupancy of sites on the virion irrespective of epitope specificity.
J. Virol.
72:3512-3519 |
| 46. | Rao, Z., A. S. Belyaev, E. Fry, P. Roy, I. M. Jones, and D. I. Stuart. 1995. Crystal structure of SIV matrix antigen and implications for virus assembly. Nature 378:743-747[CrossRef][Medline]. |
| 47. |
Robey, W. G.,
B. Safai,
S. Oroszlan,
L. Q. Arthur,
M. A. Gonda,
R. C. Gallo, and P. J. Fischinger.
1985.
Characterization of envelope and core gene products of HTLV-III with sera from AIDS patients.
Science
228:593-595 |
| 48. |
Tan, K.,
J.-H. Lee,
J.-H. Wang,
S. Shen, and M. Lu.
1997.
Atomic structure of a thermostable subdomain of HIV-1 gp41.
Proc. Natl. Acad. Sci. USA
94:12303-12308 |
| 49. |
Thali, M.,
C. Furman,
E. Helseth,
H. Repke, and J. Sodroski.
1992.
Lack of correlation between soluble CD4-induced shedding of the human immunodeficiency virus type 1 exterior envelope glycoprotein and subsequent membrane fusion events.
J. Virol.
66:5516-5524 |
| 50. | Trkola, A., T. Dragic, J. Arthos, J. M. Binley, W. C. Olson, G. P. Allaway, C. Cheng-Mayer, J. Robinson, P. J. Maddon, and J. P. Moore. 1996. CD4-dependent, antibody-sensitive interactions between HIV-1 and its co-receptor CCR-5. Nature 384:184-187[CrossRef][Medline]. |
| 51. | VanCott, T. C., J. R. Mascola, R. W. Kaminski, V. Kalyaraman, P. L. Hallberg, P. R. Burnett, J. T. Ulrich, D. J. Rechtman, and D. L. Birx. 1997. Antibodies with specificity to native gp120 and neutralization activity against primary human immunodeficiency virus type 1 isolates elicited by immunization with oligomeric gp160. J. Virol. 71:4319-4330[Abstract]. |
| 52. |
VanCott, T. C.,
J. R. Mascola,
L. D. Loomis-Price,
F. Sinangil,
N. Zitomersky,
J. McNeil,
M. L. Robb,
D. L. Birx, and S. Barnett.
1999.
Cross-subtype neutralizing antibodies induced in baboons by a subtype E gp120 immunogen based on an R5 primary human immunodeficiency virus type 1 envelope.
J. Virol.
73:4640-4650 |
| 53. |
Veronese, F. D.,
A. L. DeVico,
T. D. Copeland,
S. Oroszlan,
R. S. Gallo, and M. G. Sarngadharan.
1985.
Characterization of gp41 as the transmembrane protein coded by the HTLV-III/LAV envelope gene.
Science
229:1402-1405 |
| 54. | Weissenhorn, W., A. Dessen, S. C. Harrison, J. J. Skehel, and D. C. Wiley. 1997. Atomic structure of the ectodomain from HIV-1 gp41. Nature 387:426-430[CrossRef][Medline]. |
| 55. |
Wild, C. T.,
D. C. Shugars,
T. K. Greenwell,
C. B. McDanal, and T. J. Mathews.
1994.
Peptides corresponding to a predictive alpha-helical domain of human immunodeficiency virus type 1 gp41 are potent inhibitors of virus infection.
Proc. Natl. Acad. Sci. USA
91:9770-9774 |
| 56. |
Willey, R. L.,
M. A. Martin, and K. W. Peden.
1994.
Increase in soluble CD4 binding to and CD4-induced dissociation of gp120 from virions correlates with infectivity of human immunodeficiency virus type 1.
J. Virol.
68:1029-1039 |
| 57. | Wrin, T., and J. H. Nunberg. 1994. HIV-1 MN recombinant gp120 vaccine serum, which fails to neutralize primary isolates of HIV-1, does not antagonize neutralization by antibodies from infected individuals. AIDS 8:1622-1623[CrossRef][Medline]. |
| 58. | Wu, L., N. P. Gerard, R. Wyatt, H. Choe, C. Parolin, N. Ruffing, A. Borsetti, A. A. Cardoso, E. Desjardins, W. Newman, C. Gerard, and J. Sodroski. 1996. CD4-induced interaction of primary HIV-1 gp120 glycoproteins with the chemokine receptor CCR-5. Nature 384:179-183[CrossRef][Medline]. |
| 59. | Wyatt, R., E. Desjardins, U. Olshevsky, C. Nixon, J. Binley, V. Olshevsky, and J. Sodroski. 1997. Analysis of the interaction of the human immunodeficiency virus type 1 gp120 envelope glycoprotein with the gp41 transmembrane glycoprotein. J. Virol. 71:9722-9731[Abstract]. |
| 60. |
Yang, X.,
L. Florin,
M. Farzan,
P. Kolchinsky,
P. Kwong,
J. Sodroski, and R. Wyatt.
2000.
Modifications that stabilize human immunodeficiency virus envelope glycoprotein trimers in solution.
J. Virol.
74:4746-4754 |
| 61. | Yang, Z. N., T. Mueser, J. Kaufman, S. Stahl, P. Wingfield, and C. C. Hyde. 1999. The crystal structure of the SIV gp41 ectodomain at 1.47 Å resolution. J. Struct. Biol. 126:131-144[CrossRef][Medline]. |
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»