This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Jenison, S
Right arrow Articles by Hjelle, B
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Jenison, S
Right arrow Articles by Hjelle, B

 Previous Article  |  Next Article 

J Virol. 1994 May; 68(5): 3000-3006

Characterization of human antibody responses to four corners hantavirus infections among patients with hantavirus pulmonary syndrome.

S Jenison, T Yamada, C Morris, B Anderson, N Torrez-Martinez, N Keller and B Hjelle

Department of Medicine, University of New Mexico School of Medicine, Albuquerque 87131.

ABSTRACT

Hantavirus pulmonary syndrome (HPS) is a human disease caused by a newly identified hantavirus, which we will refer to as Four Corners virus (FCV). FCV is related most closely to Puumala virus (PUU) and to Prospect Hill virus (PHV). Twenty-five acute HPS serum samples were tested for immunoglobulin G (IgG) and IgM antibody reactivities to FCV-encoded recombinant proteins in Western blot (immunoblot) assays. All HPS serum samples contained both IgG and IgM antibodies to the FCV nucleocapsid (N) protein. FCV N antibodies cross-reacted with PUU N and PHV N proteins. A dominant FCV N epitope was mapped to the segment between amino acids 17 and 59 (QLVTARQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETKLG). All HPS serum samples contained IgG antibodies to the FCV glycoprotein-1 (G1) protein, and 21 of 25 serum samples contained FCV G1 IgM antibodies. The FCV G1 antibodies did not cross-react with PUU G1 and PHV G1 proteins. The FCV G1 type-specific antibody reactivity mapped to a segment between amino acids 59 and 89 (LKIESSCNFDLHVPATTTQKYNQVDWTKKSS). One hundred twenty-eight control serum samples were tested for IgG reactivities to the FCV N and G1 proteins. Nine (7.0%) contained FCV N reactivities, 3 (2.3%) contained FCV G1 reactivities, and one (0.8%) contained both FCV N and FCV G1 reactivities. The epitopes recognized by antibodies present in control serum samples were different from the epitopes recognized by HPS antibodies, suggesting that the control antibody reactivities were unrelated to FCV infections. These reagents constitute a type-specific assay for FCV antibodies.

J Virol. 1994 May; 68(5): 3000-3006




This article has been cited by other articles:

  • Hall, P. R., Hjelle, B., Brown, D. C., Ye, C., Bondu-Hawkins, V., Kilpatrick, K. A., Larson, R. S. (2008). Multivalent Presentation of Antihantavirus Peptides on Nanoparticles Enhances Infection Blockade. Antimicrob. Agents Chemother. 52: 2079-2088 [Abstract] [Full Text]  
  • Maeda, K., West, K., Toyosaki-Maeda, T., Rothman, A. L., Ennis, F. A., Terajima, M. (2004). Identification and analysis for cross-reactivity among hantaviruses of H-2b-restricted cytotoxic T-lymphocyte epitopes in Sin Nombre virus nucleocapsid protein. J. Gen. Virol. 85: 1909-1919 [Abstract] [Full Text]  
  • Botten, J., Mirowsky, K., Kusewitt, D., Ye, C., Gottlieb, K., Prescott, J., Hjelle, B. (2002). Persistent Sin Nombre Virus Infection in the Deer Mouse (Peromyscus maniculatus) Model: Sites of Replication and Strand-Specific Expression. J. Virol. 77: 1540-1550 [Abstract] [Full Text]  
  • LLEDO, L., GEGUNDEZ, M.I., SAZ, J.V., ALVES, M.J., BELTRAN, M. (2002). Serological study of hantavirus in man in the Autonomous Community of Madrid, Spain. J Med Microbiol 51: 861-865 [Abstract] [Full Text]  
  • Botten, J., Mirowsky, K., Ye, C., Gottlieb, K., Saavedra, M., Ponce, L., Hjelle, B. (2002). Shedding and Intracage Transmission of Sin Nombre Hantavirus in the Deer Mouse (Peromyscus maniculatus) Model. J. Virol. 76: 7587-7594 [Abstract] [Full Text]  
  • Ramos, M. M., Overturf, G. D., Crowley, M. R., Rosenberg, R. B., Hjelle, B. (2001). Infection With Sin Nombre Hantavirus: Clinical Presentation and Outcome in Children and Adolescents. Pediatrics 108 : e27-e27 [Abstract] [Full Text]  
  • Hughes, A. L., Friedman, R. (2000). Evolutionary Diversification of Protein-Coding Genes of Hantaviruses. Mol Biol Evol 17: 1558-1568 [Abstract] [Full Text]  
  • Feuer, R., Boone, J. D., Netski, D., Morzunov, S. P., St. Jeor, S. C. (1999). Temporal and Spatial Analysis of Sin Nombre Virus Quasispecies in Naturally Infected Rodents. J. Virol. 73: 9544-9554 [Abstract] [Full Text]  
  • Magurano, F., Nicoletti, L. (1999). Humoral Response in Toscana Virus Acute Neurologic Disease Investigated by Viral-Protein-Specific Immunoassays. CVI 6: 55-60 [Abstract] [Full Text]  
  • Gavrilovskaya, I., LaMonica, R., Fay, M.-E., Hjelle, B., Schmaljohn, C., Shaw, R., Mackow, E. R. (1999). New York 1 and Sin Nombre Viruses Are Serotypically Distinct Viruses Associated with Hantavirus Pulmonary Syndrome. J. Clin. Microbiol. 37: 122-126 [Abstract] [Full Text]  
  • Morzunov, S. P., Rowe, J. E., Ksiazek, T. G., Peters, C. J., St. Jeor, S. C., Nichol, S. T. (1998). Genetic Analysis of the Diversity and Origin of Hantaviruses in Peromyscus leucopus Mice in North America. J. Virol. 72: 57-64 [Abstract] [Full Text]  
  • Peters, C. J., Khan, A. S., zaki, S. R. (1996). Hantaviruses in the United States. Arch Intern Med 156: 705-707 [Abstract]  
  • White, D. J., Means, R. G., Birkhead, G. S., Bosler, E. M., Grady, L. J., Chatterjee, N., Woodall, J., Hjelle, B., Rollin, P. E., Ksiazek, T. G., Morse, D. L. (1996). Human and Rodent Hantavirus Infection in New York State: Public Health Significance of an Emerging Infectious Disease. Arch Intern Med 156: 722-726 [Abstract]  


Copyright © 2009 by the American Society for Microbiology.   For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»